Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otx2 Antibody

Orthodenticle homeobox 2 is also known as CPHD6 or MCOPS5. The OTX2 gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. Otx2 acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6) . Otx2 is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

Host

Rabbit

Reactivity

Human

Immunogen

An amino acid sequence from the C-terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) was used as the immunogen for this Otx2 antibody (100% mouse homology) .

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Otx2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Otx2 antibody is available for research use only.

Storage Conditions

After reconstitution, the Otx2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

The stated application concentrations are suggested starting amounts. Titration of the Otx2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Image Legend

Western blot testing of Otx2 antibody and COLO320 lysate. Predicted/observed size ~32KD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhotekin antibody
70R-2624 50 ug

Rhotekin antibody

Sign In for Pricing
View Details
LEMD3 Antibody
MBS151102-01 0.1 mg

LEMD3 Antibody

Sign In for Pricing
View Details
LEMD3 Antibody
MBS151102-02 5x 0.1 mg

LEMD3 Antibody

Sign In for Pricing
View Details
Carvedilol Related Compound A
YXB09073-01 50 mg

Carvedilol Related Compound A

Sign In for Pricing
View Details
Carvedilol Related Compound A
YXB09073-02 0.5 g

Carvedilol Related Compound A

Sign In for Pricing
View Details
Human WDR37 activation kit by CRISPRa
GA107882 1 Kit

Human WDR37 activation kit by CRISPRa

Sign In for Pricing
View Details