Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY Antibody / Neuropeptide Y

Neuropeptide Y is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. Neuropeptide Y also exhibits antimicrobial activity against bacteria and fungi.

Product Specifications

CAS Number

9007-83-4

Specifications

IHC (FFPE) : 0.5-1 µg/mL, Western Blot (recombinant protein) : 0.5-1 µg/mL

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

An amino acid sequence from the middle region of human Neuropeptide Y (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY) was used as the immunogen for this NPY antibody (100% homologous in human, mouse and rat) .

Clonality

Polyclonal

Isotype

IgG

Applications

IHC-P, WB (recombinant protein)

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the NPY antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This NPY antibody is available for research use only.

Storage Conditions

After reconstitution, the NPY antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

The stated application concentrations are suggested starting amounts. Titration of the NPY antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Location

Cytoplasmic & secreted

Image Legend

IHC-P: NPY antibody testing of mouse brain tissue

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BTBD15 Antibody [DyLight 594]
NBP1-78185DL594 0.1 mL

Rabbit Polyclonal BTBD15 Antibody [DyLight 594]

Sign In for Pricing
View Details
3-Chloro-2-Hydrazino-1,2-Dihydropyrazine Hydrochloride
231778-01 250 mg

3-Chloro-2-Hydrazino-1,2-Dihydropyrazine Hydrochloride

Sign In for Pricing
View Details
3-Chloro-2-Hydrazino-1,2-Dihydropyrazine Hydrochloride
231778-02 1 g

3-Chloro-2-Hydrazino-1,2-Dihydropyrazine Hydrochloride

Sign In for Pricing
View Details
3-Chloro-2-Hydrazino-1,2-Dihydropyrazine Hydrochloride
231778-03 5 g

3-Chloro-2-Hydrazino-1,2-Dihydropyrazine Hydrochloride

Sign In for Pricing
View Details
Bovine LTF ELISA Kit
orb403278-01 24 Tests

Bovine LTF ELISA Kit

Sign In for Pricing
View Details
Bovine LTF ELISA Kit
orb403278-02 48 Tests

Bovine LTF ELISA Kit

Sign In for Pricing
View Details