Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX2 Antibody

Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

Host

Rabbit

Reactivity

Human

Immunogen

An amino acid sequence from the middle region of human RUNX2 (DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN) was used as the immunogen for this RUNX2 antibody (100% mouse homology) .

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the RUNX2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This RUNX2 antibody is available for research use only.

Storage Conditions

After reconstitution, the RUNX2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

The stated application concentrations are suggested starting amounts. Titration of the RUNX2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Image Legend

Western blot testing of RUNX2 antibody and Lane 1: HeLa; 2: A431; 3: K562; 4: Jurkat. Predicted molecular weight: 50-60 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHA11 Polyclonal Antibody Bio Conjugated
orb1541147 100 µL

PCDHA11 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
MVK, Human, BioAssayTM IP-WB Antibody Pair (Mevalonate Kinase, FLJ96772, LRBP, MK, MVLK) discontinued
207805 1 Set

MVK, Human, BioAssayTM IP-WB Antibody Pair (Mevalonate Kinase, FLJ96772, LRBP, MK, MVLK) discontinued

Sign In for Pricing
View Details
Human TMEM107 Protein Lysate
MBS8428659-01 0.02 mg

Human TMEM107 Protein Lysate

Sign In for Pricing
View Details
Human TMEM107 Protein Lysate
MBS8428659-02 5x 0.02 mg

Human TMEM107 Protein Lysate

Sign In for Pricing
View Details
MicroMesh Epoxied Assembly Head Diameter and Mesh Opening 300/25IN1 (in um) Base Style B1
B-M3-300/25IN1-B1 20 Mounts/Base Assemblies

MicroMesh Epoxied Assembly Head Diameter and Mesh Opening 300/25IN1 (in um) Base Style B1

Sign In for Pricing
View Details
Interleukin 11 (IL-11) (PE)
MBS6482984-01 0.1 mL

Interleukin 11 (IL-11) (PE)

Sign In for Pricing
View Details