Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX1 Antibody / AML1

Runt-related transcription factor 1, also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called Core binding factor alpha (CBFa) . RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFb which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the gene are associated with several types of leukemia including M2 AML. Mutations are implicated in cases of breast cancer.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE & Frozen) : 1-2 µg/mL

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

An amino acid sequence from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN) was used as the immunogen for this RUNX1 antibody (100% homologous in human, mouse and rat) .

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, IHC-F

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the RUNX1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This RUNX1 antibody is available for research use only.

Storage Conditions

After reconstitution, the RUNX1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

The stated application concentrations are suggested starting amounts. Titration of the RUNX1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Image Legend

Western blot testing of 1) human HL60, 2) rat thymus and 3) mouse thymus with RUNX1 antibody. Predicted molecular weight ~49 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ODAPH Rabbit Polyclonal Antibody (FITC)
orb2589177 100 µg

ODAPH Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Regucalcin/RGN Rabbit Polyclonal Antibody (Fluoro647)
orb3102796 100 µg

Regucalcin/RGN Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
APOA4 Knockout Hela Polyclonal Cells
ARG20863 1 Million

APOA4 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral human CXorf65 sgRNA gene knockout kit - Lentiviral human CXorf65 sgRNA gene knockout kit (100)
GTR15377725 1 Vial

Lentiviral human CXorf65 sgRNA gene knockout kit - Lentiviral human CXorf65 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TGFBI Antibody
orb3162425-01 50 µL

TGFBI Antibody

Sign In for Pricing
View Details
TGFBI Antibody
orb3162425-02 100 µL

TGFBI Antibody

Sign In for Pricing
View Details