Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmi1 Antibody

B lymphoma Mo MLV insertion region 1, also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human gene is assigned to chromosome 10p13. It has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that the protein completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16 (INK4) . BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that the protein transiently colocalized with centromeres during interphase in HeLa cells.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

An amino acid sequence from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR) was used as the immunogen for this Bmi1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Bmi1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Bmi1 antibody is available for research use only.

Storage Conditions

After reconstitution, the Bmi1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

The stated application concentrations are suggested starting amounts. Titration of the Bmi1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Image Legend

Western blot testing of Bmi1 antibody and Lane 1: rat spleen; 2: human HT1080; 3: (h) HeLa. Predicted molecular weight: 37-43 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl 4-benzyloxybenzoate
FB71105-01 1 g

Benzyl 4-benzyloxybenzoate

Sign In for Pricing
View Details
Benzyl 4-benzyloxybenzoate
FB71105-02 2 g

Benzyl 4-benzyloxybenzoate

Sign In for Pricing
View Details
Benzyl 4-benzyloxybenzoate
FB71105-03 5 g

Benzyl 4-benzyloxybenzoate

Sign In for Pricing
View Details
Benzyl 4-benzyloxybenzoate
FB71105-04 10 g

Benzyl 4-benzyloxybenzoate

Sign In for Pricing
View Details
Benzyl 4-benzyloxybenzoate
FB71105-05 25 g

Benzyl 4-benzyloxybenzoate

Sign In for Pricing
View Details
Microscope Slides Maize Grain TS
4041650/21 1 Each

Microscope Slides Maize Grain TS

Sign In for Pricing
View Details