Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP2A2 Antibody

SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca (2+) -ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca (2+) -ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles; germinative and mature cells of sebaceous glands; secretory coil and duct of eccrine glands; apocrine gland cells; and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

An amino acid sequence from the N-terminus of human ATP2A2 (MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) was used as the immunogen for this ATP2A2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the ATP2A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ATP2A2 antibody is available for research use only.

Storage Conditions

After reconstitution, the ATP2A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

The stated application concentrations are suggested starting amounts. Titration of the ATP2A2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Image Legend

Western blot testing of ATP2A2 antibody and Lane 1: rat skeletal muscle; 2: mouse skeletal muscle; Expected molecular weight ~115 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flt3 antibody
20R-FR010 0.05 mg

Flt3 antibody

Sign In for Pricing
View Details
Pamrevlumab Biosimilar - Anti-CTGF, IGFBP-8 mAb - Research Grade
PX-TA1386-1000UG 1 mg

Pamrevlumab Biosimilar - Anti-CTGF, IGFBP-8 mAb - Research Grade

Sign In for Pricing
View Details
ZN746 Rabbit Polyclonal Antibody
MBS9518054-01 0.05 mL

ZN746 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZN746 Rabbit Polyclonal Antibody
MBS9518054-02 0.1 mL

ZN746 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZN746 Rabbit Polyclonal Antibody
MBS9518054-03 5x 0.1 mL

ZN746 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BC049352 Protein Vector (Mouse) (pPB-N-His)
PV158735 500 ng

BC049352 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details