Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP2A1 Antibody / SERCA1

SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca (2+) -ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

An amino acid sequence from the N-terminus of human ATP2A1 (MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) was used as the immunogen for this ATP2A1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the ATP2A1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This ATP2A1 antibody is available for research use only.

Storage Conditions

After reconstitution, the ATP2A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

The stated application concentrations are suggested starting amounts. Titration of the ATP2A1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Image Legend

Immunohistochemical staining of FFPE human skeletal muscle tissue with ATP2A1 antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Dkk1 Antibody , Carrier-free
A00632-3-carrier-free 100 µg/Vial

Anti-Dkk1 Antibody , Carrier-free

Sign In for Pricing
View Details
Recombinant Deinococcus radiodurans CTP synthase (pyrG), partial
MBS1337572 Inquire

Recombinant Deinococcus radiodurans CTP synthase (pyrG), partial

Sign In for Pricing
View Details
Recombinant Human LEP Protein, N-His
orb3061773-01 50 µg

Recombinant Human LEP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human LEP Protein, N-His
orb3061773-02 100 µg

Recombinant Human LEP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human LEP Protein, N-His
orb3061773-03 1 mg

Recombinant Human LEP Protein, N-His

Sign In for Pricing
View Details
Recombinant Shigella Boydii pdxB Protein (aa 1-378) (strain CDC 3083-94 / BS512)
VAng-Lsx09264-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Boydii pdxB Protein (aa 1-378) (strain CDC 3083-94 / BS512)

Sign In for Pricing
View Details