Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteasome activator complex subunit 3 (PSME3), partial

Product Specifications

Product Name Alternative

(11S regulator complex subunit gamma) (REG-gamma) (Activator of multicatalytic protease subunit 3) (Ki nuclear autoantigen) (Proteasome activator 28 subunit gamma) (PA28g) (PA28gamma)

Abbreviation

Recombinant Human PSME3 protein, partial

Gene Name

PSME3

UniProt

P61289

Expression Region

2-252aa

Organism

Homo sapiens (Human)

Target Sequence

ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAET

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Apoptosis

Relevance

Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1 inhibition.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

60.6 kDa

References & Citations

Cloning and nucleotide sequence of cDNA for Ki antigen, a highly conserved nuclear protein detected with sera from patients with systemic lupus erythematosus.Nikaido T., Shimada K., Shibata M., Hata M., Sakamoto M., Takasaki Y., Sato C., Takahashi T., Nishida Y.Clin. Exp. Immunol. 79:209-214 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB8 (NM_002640) Human Recombinant Protein
TP323880M 100 µg

SERPINB8 (NM_002640) Human Recombinant Protein

Sign In for Pricing
View Details
EGR4 Human Gene Knockout Kit (CRISPR)
KN421199 1 Kit

EGR4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTMS (NM_002824) Human Over-expression Lysate
LY419066 100 µg

PTMS (NM_002824) Human Over-expression Lysate

Sign In for Pricing
View Details
ETK (Ab-40) Antibody
8B0645-AAT 50 µg

ETK (Ab-40) Antibody

Sign In for Pricing
View Details
RSK3 (RPS6KA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10F11]
TA809900AM 100 µL

RSK3 (RPS6KA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10F11]

Sign In for Pricing
View Details
Folinic Acid
TRC-F680340-1MG 1 mg

Folinic Acid

Sign In for Pricing
View Details