Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1D, Human (His)

The C1D protein has multifunctionality in cellular processes, recruiting RNA exosome complexes for 5.8S rRNA processing, possibly in conjunction with MPHOSPH6. It activates PRKDC with linear and supercoiled DNA and induces apoptosis through the p53/TP53 pathway. C1D Protein, Human (His) is the recombinant human-derived C1D protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

C1D Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1d-protein-human-gst.html

Purity

95.00

Smiles

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

Molecular Formula

10438 (Gene_ID) Q13901 (M1-S141) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC6 Antibody
KC-1769-01 50 μL

XRCC6 Antibody

Sign In for Pricing
View Details
XRCC6 Antibody
KC-1769-02 100 µL

XRCC6 Antibody

Sign In for Pricing
View Details
XRCC6 Antibody
KC-1769-03 1 mL

XRCC6 Antibody

Sign In for Pricing
View Details
Thebainone
TRC-T342500-5MG 5 mg

Thebainone

Sign In for Pricing
View Details
Uncoated Mouse ANG (Angiogenin) ELISA Kit
E-UNEL-M0188-01 5x 96 Tests

Uncoated Mouse ANG (Angiogenin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse ANG (Angiogenin) ELISA Kit
E-UNEL-M0188-02 15x 96 Tests

Uncoated Mouse ANG (Angiogenin) ELISA Kit

Sign In for Pricing
View Details