Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1D, Human (His)

The C1D protein has multifunctionality in cellular processes, recruiting RNA exosome complexes for 5.8S rRNA processing, possibly in conjunction with MPHOSPH6. It activates PRKDC with linear and supercoiled DNA and induces apoptosis through the p53/TP53 pathway. C1D Protein, Human (His) is the recombinant human-derived C1D protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

C1D Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1d-protein-human-gst.html

Purity

95.00

Smiles

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

Molecular Formula

10438 (Gene_ID) Q13901 (M1-S141) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPTXR Antibody
OC-308-01 50 μL

NPTXR Antibody

Sign In for Pricing
View Details
NPTXR Antibody
OC-308-02 100 µL

NPTXR Antibody

Sign In for Pricing
View Details
NPTXR Antibody
OC-308-03 1 mL

NPTXR Antibody

Sign In for Pricing
View Details
CTNND1 (NM_001085458) Human Over-expression Lysate
LY421307 100 µg

CTNND1 (NM_001085458) Human Over-expression Lysate

Sign In for Pricing
View Details
TACA
TRC-T004010-10MG 10 mg

TACA

Sign In for Pricing
View Details
NCOA2 (NM_006540) Human Over-expression Lysate
LY401959 100 µg

NCOA2 (NM_006540) Human Over-expression Lysate

Sign In for Pricing
View Details