Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1D, Human (His)

The C1D protein has multifunctionality in cellular processes, recruiting RNA exosome complexes for 5.8S rRNA processing, possibly in conjunction with MPHOSPH6. It activates PRKDC with linear and supercoiled DNA and induces apoptosis through the p53/TP53 pathway. C1D Protein, Human (His) is the recombinant human-derived C1D protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

C1D Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1d-protein-human-gst.html

Purity

95.00

Smiles

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

Molecular Formula

10438 (Gene_ID) Q13901 (M1-S141) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Air Cooled Chiller BCHI-104
BCHI-104 Each

Air Cooled Chiller BCHI-104

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker), CF488A conjugate, 0.1mg/mL
BNC881662-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VCAM1 Mouse Monoclonal Antibody [Clone ID: B-K9]
AM31190AF-N 200 µg

VCAM1 Mouse Monoclonal Antibody [Clone ID: B-K9]

Sign In for Pricing
View Details
LRRC61 Human Gene Knockout Kit (CRISPR)
KN400951 1 Kit

LRRC61 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF740 conjugate, 0.1mg/mL
BNC741041-500 1x 500 µL

TRIM29 (TRIM29/1041), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALF (GTF2A1L) Mouse Monoclonal Antibody [Clone ID: OTI4B4]
CF810961 100 µg

ALF (GTF2A1L) Mouse Monoclonal Antibody [Clone ID: OTI4B4]

Sign In for Pricing
View Details