Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1D, Human (His)

The C1D protein has multifunctionality in cellular processes, recruiting RNA exosome complexes for 5.8S rRNA processing, possibly in conjunction with MPHOSPH6. It activates PRKDC with linear and supercoiled DNA and induces apoptosis through the p53/TP53 pathway. C1D Protein, Human (His) is the recombinant human-derived C1D protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

C1D Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1d-protein-human-gst.html

Purity

95.00

Smiles

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

Molecular Formula

10438 (Gene_ID) Q13901 (M1-S141) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac-Naproxen 2-Propyl Ester
TRC-N377560-250MG 250 mg

rac-Naproxen 2-Propyl Ester

Sign In for Pricing
View Details
Hydroxybutenolide
TRC-H830805-25MG 25 mg

Hydroxybutenolide

Sign In for Pricing
View Details
CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: OTI2F6]
CF805375 100 µg

CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: OTI2F6]

Sign In for Pricing
View Details
Crystallin Alpha B (CPTC-CRYAB-1), 0.2mg/mL
BNUB2235-500 1x 500 µL

Crystallin Alpha B (CPTC-CRYAB-1), 0.2mg/mL

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), CF488A conjugate, 0.1mg/mL
BNC882275-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcam Mouse Gene Knockout Kit (CRISPR)
KN502076 1 Kit

Bcam Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details