Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-36 gamma (Il36g), partial

Product Specifications

Product Name Alternative

Interleukin-1 family member 9; IL-1F9

Abbreviation

Recombinant Mouse Il36g protein, partial

Gene Name

Il36g

UniProt

Q8R460

Expression Region

13-164aa

Organism

Mus musculus (Mouse)

Target Sequence

GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Functions as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in pro-inflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of pro-inflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4 (+) T-cells and splenocytes.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-(-)-1,3-Butanediol
TRC-B710010-1G 1 g

(R)-(-)-1,3-Butanediol

Sign In for Pricing
View Details
3-(4-Chlorophenyl)glutaric Acid
TRC-C378250-5G 5 g

3-(4-Chlorophenyl)glutaric Acid

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF647 conjugate, 0.1mg/mL
BNC470859-100 1x 100 µL

Human Kappa Light Chain (Kap-56), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Morniga G Lectin (black mulberry) -MNA-G-
LA-9005-1 1 mg

Alkaline Phosphatase Conjugated Morniga G Lectin (black mulberry) -MNA-G-

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS705461 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
RRM2 Rabbit Monoclonal Antibody [Clone ID: SAIC-30C-18]
TA385903 200 µg

RRM2 Rabbit Monoclonal Antibody [Clone ID: SAIC-30C-18]

Sign In for Pricing
View Details