Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LD78-beta/CCL3L1, Human (HEK293 His)

LD78-beta/CCL3L1 Protein, Human (HEK293 His) is a multiallelic copy number variable, which plays a crucial role in immunoregulatory and hosts defense through the production of macrophage inflammatory protein (MIP) -1α.

Product Specifications

Product Name Alternative

LD78-beta/CCL3L1 Protein, Human (HEK293 His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ld78-beta-ccl3l1-protein-human-hek293-his.html

Purity

98.0

Smiles

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAHHHHHH

Molecular Formula

414062/ 6349 (Gene_ID) P16619 (A24-A93) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jalilah Jamaluddin, et al. Copy number variation of CCL3L1 among three major ethnic groups in Malaysia. BMC Genet. 2020 Jan 3;21 (1) :1.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prime Juice DNA Fluoresence Preloading Stain, sample
orb2280590 50 µL

Prime Juice DNA Fluoresence Preloading Stain, sample

Sign In for Pricing
View Details
LTK, Mouse (HEK293, His)
HY-P703767 1 Each

LTK, Mouse (HEK293, His)

Sign In for Pricing
View Details
Lrrc10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
27619116 3x 1.0 µg

Lrrc10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse Ckap5 Pre-designed siRNA Set A
SI102648A 1 Each

Mouse Ckap5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
NDUFS5 Antibody (N-Term)
MBS9216721-01 0.05 mL

NDUFS5 Antibody (N-Term)

Sign In for Pricing
View Details
NDUFS5 Antibody (N-Term)
MBS9216721-02 0.2 mL

NDUFS5 Antibody (N-Term)

Sign In for Pricing
View Details