Lumican/LUM, Mouse (HEK293, His)
Lumican/LUM protein binds specifically to laminin.Lumican/LUM Protein, Mouse (HEK293, His) is the recombinant mouse-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
Lumican/LUM Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lumican-protein-mouse-hek-293-his.html
Purity
98.0
Smiles
QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
Molecular Formula
17022 (Gene_ID) P51885 (Q19-N338) (Accession)
Molecular Weight
40-60 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680029-500 1x 500 µL
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042983-500 1x 500 µL
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details