Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTP1, Human

Glutathione S-transferase P (GSTP1) is a member of GSTs family and plays an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 enables JUN kinase binding activity; glutathione transferase activity; and kinase regulator activity and is involved in negative regulation of cell population proliferation, intracellular signal transduction and macromolecule metabolic process as well. GSTP1 Protein, Human is the recombinant human-derived GSTP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GSTP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glutathione-s-transferase-p-gstp1-protein-human.html

Purity

98.0

Smiles

MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Molecular Formula

2950 (Gene_ID) AAH10915.1 (M1-Q210) (Accession)

Molecular Weight

Approximately 22-25 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Slamf1 Rat Monoclonal Antibody [Clone ID: 9D1]
SM2026R 100 Tests

Slamf1 Rat Monoclonal Antibody [Clone ID: 9D1]

Ask
View Details
Zfx ORF Vector (Rat) (pORF)
51220016 1.0 µg DNA

Zfx ORF Vector (Rat) (pORF)

Ask
View Details
PCDHGA12 (NM_003735) Human Over-expression Lysate
LS026025-100ug 100 µg

PCDHGA12 (NM_003735) Human Over-expression Lysate

Ask
View Details
Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS9393498-01 48 Well

Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Ask
View Details
Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS9393498-02 96 Well

Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Ask
View Details
Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS9393498-03 5x 96 Well

Camel Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Ask
View Details