Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTP1, Human

Glutathione S-transferase P (GSTP1) is a member of GSTs family and plays an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 enables JUN kinase binding activity; glutathione transferase activity; and kinase regulator activity and is involved in negative regulation of cell population proliferation, intracellular signal transduction and macromolecule metabolic process as well. GSTP1 Protein, Human is the recombinant human-derived GSTP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GSTP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glutathione-s-transferase-p-gstp1-protein-human.html

Purity

98.0

Smiles

MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Molecular Formula

2950 (Gene_ID) AAH10915.1 (M1-Q210) (Accession)

Molecular Weight

Approximately 22-25 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human HINT1 shRNA (UAS) - Lentiviral human HINT1 shRNA (UAS, GFP) (25)
GTR15352295 1 Vial

Lentiviral human HINT1 shRNA (UAS) - Lentiviral human HINT1 shRNA (UAS, GFP) (25)

Ask
View Details
Human CDY1 activation kit by CRISPRa
GA106046 1 Kit

Human CDY1 activation kit by CRISPRa

Ask
View Details
RBMXL3 Human shRNA Plasmid Kit (Locus ID 139804)
TR317881 1 Kit

RBMXL3 Human shRNA Plasmid Kit (Locus ID 139804)

Ask
View Details