Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTP1, Human

Glutathione S-transferase P (GSTP1) is a member of GSTs family and plays an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 enables JUN kinase binding activity; glutathione transferase activity; and kinase regulator activity and is involved in negative regulation of cell population proliferation, intracellular signal transduction and macromolecule metabolic process as well. GSTP1 Protein, Human is the recombinant human-derived GSTP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GSTP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glutathione-s-transferase-p-gstp1-protein-human.html

Purity

98.0

Smiles

MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Molecular Formula

2950 (Gene_ID) AAH10915.1 (M1-Q210) (Accession)

Molecular Weight

Approximately 22-25 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Kylt® Cryptosporidium parvum
31324 100 Reactions

Kylt® Cryptosporidium parvum

Ask
View Details
Lentiviral human AMELY shRNA (UAS) - Lentiviral human AMELY shRNA (UAS, GFP) (25)
GTR15086336 1 Vial

Lentiviral human AMELY shRNA (UAS) - Lentiviral human AMELY shRNA (UAS, GFP) (25)

Ask
View Details
GPR30 (GPER, CMKRL2, CEPR, FEG-1, G-Protein Coupled Receptor 30, G-Protein-Coupled Receptor 30, GPCR-Br, Heptahelix Receptor, LERGU, LyGPR, MER, IL8-related Receptor DRY12, LERGU2, Chemokine Receptor-like 2, DRY12, Membrane Estrogen Receptor)
170706 50 µg

GPR30 (GPER, CMKRL2, CEPR, FEG-1, G-Protein Coupled Receptor 30, G-Protein-Coupled Receptor 30, GPCR-Br, Heptahelix Receptor, LERGU, LyGPR, MER, IL8-related Receptor DRY12, LERGU2, Chemokine Receptor-like 2, DRY12, Membrane Estrogen Receptor)

Ask
View Details
Rabbit Polyclonal FAM8A1 Antibody [Alexa Fluor 405]
NBP2-47125AF405 0.1 mL

Rabbit Polyclonal FAM8A1 Antibody [Alexa Fluor 405]

Ask
View Details
RBBP4 Peptide - N-terminal region
MBS3237847-01 0.1 mg

RBBP4 Peptide - N-terminal region

Ask
View Details
RBBP4 Peptide - N-terminal region
MBS3237847-02 5x 0.1 mg

RBBP4 Peptide - N-terminal region

Ask
View Details