IgG2A Fc, Rat (HEK293)
Ig gamma-2A chain C region (IgG2a) is one of the IgG antibodies subclasses and responses to an antigen. IgG2a plays a crucial role in the adaptive immune response[1][2]. IgG2A Fc Protein, Rat (HEK293) is the recombinant rat-derived IgG2A Fc protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
IgG2A Fc Protein, Rat (HEK293), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igg2a-fc-protein-rat-hek-293.html
Purity
95.0
Smiles
VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Molecular Formula
679045 (Gene_ID) P20760 (V98-K322) (Accession)
Molecular Weight
30-35 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470977-500 1x 500 µL
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details