IgG2A Fc, Rat (HEK293)
Ig gamma-2A chain C region (IgG2a) is one of the IgG antibodies subclasses and responses to an antigen. IgG2a plays a crucial role in the adaptive immune response[1][2]. IgG2A Fc Protein, Rat (HEK293) is the recombinant rat-derived IgG2A Fc protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
IgG2A Fc Protein, Rat (HEK293), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igg2a-fc-protein-rat-hek-293.html
Purity
95.0
Smiles
VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Molecular Formula
679045 (Gene_ID) P20760 (V98-K322) (Accession)
Molecular Weight
30-35 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal CD8 beta Antibody (CBB/1595) [Alexa Fluor 594]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP3-08335AF594 100 µL
Mouse Monoclonal CD8 beta Antibody (CBB/1595) [Alexa Fluor 594]
Sign In for Pricing
View Details ![HPCAL4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C3]](https://cdn.genprice.uk/products/937/68dd1b80061270361ea1e4ee/imageurl/ta808680am.webp)
TA808680AM 100 µL
HPCAL4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C3]
Sign In for Pricing
View Details 
MBS1286594-01 0.02 mg (E-Coli)
Recombinant Shigella flexneri serotype 5b Orotate phosphoribosyltransferase (pyrE)
Sign In for Pricing
View Details MBS1286594-02 0.1 mg (E-Coli)
Recombinant Shigella flexneri serotype 5b Orotate phosphoribosyltransferase (pyrE)
Sign In for Pricing
View Details 
MBS1286594-03 0.02 mg (Yeast)
Recombinant Shigella flexneri serotype 5b Orotate phosphoribosyltransferase (pyrE)
Sign In for Pricing
View Details