IgG2A Fc, Rat (HEK293)
Ig gamma-2A chain C region (IgG2a) is one of the IgG antibodies subclasses and responses to an antigen. IgG2a plays a crucial role in the adaptive immune response[1][2]. IgG2A Fc Protein, Rat (HEK293) is the recombinant rat-derived IgG2A Fc protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
IgG2A Fc Protein, Rat (HEK293), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igg2a-fc-protein-rat-hek-293.html
Purity
95.0
Smiles
VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Molecular Formula
679045 (Gene_ID) P20760 (V98-K322) (Accession)
Molecular Weight
30-35 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
EIA07539r 1 Kit
Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
Sign In for Pricing
View Details RC205438L4 10 µg
Prion protein PrP (PRNP) (NM_000311) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
MBS2904742-01 48 Well
Human PLOD1/Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 ELISA Kit
Sign In for Pricing
View Details