Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2A Fc, Rat (HEK293)

Ig gamma-2A chain C region (IgG2a) is one of the IgG antibodies subclasses and responses to an antigen. IgG2a plays a crucial role in the adaptive immune response[1][2]. IgG2A Fc Protein, Rat (HEK293) is the recombinant rat-derived IgG2A Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2A Fc Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2a-fc-protein-rat-hek-293.html

Purity

95.0

Smiles

VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK

Molecular Formula

679045 (Gene_ID) P20760 (V98-K322) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human pre-microRNA Expression Construct let-7e
PMIRHlet7ePA-1 Bacterial Streak

Human pre-microRNA Expression Construct let-7e

Sign In for Pricing
View Details
STAG3L2, ID (STAG3L2, STAG3-like protein 2, Stromal antigen 3-like protein 2) (FITC) discontinued
042365-FITC 200 µL

STAG3L2, ID (STAG3L2, STAG3-like protein 2, Stromal antigen 3-like protein 2) (FITC) discontinued

Sign In for Pricing
View Details
Vasopressin-neurophysin 2-copeptin (AVP)
339392-01 50 µg

Vasopressin-neurophysin 2-copeptin (AVP)

Sign In for Pricing
View Details
Vasopressin-neurophysin 2-copeptin (AVP)
339392-02 100 µg

Vasopressin-neurophysin 2-copeptin (AVP)

Sign In for Pricing
View Details
SPANXB2 (NM_145664) Human Tagged Lenti ORF Clone
RC205245L3 10 µg

SPANXB2 (NM_145664) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
hsa-miR-95-3p miRNA Antagomir
MNH03960 2x 5.0 nmol

hsa-miR-95-3p miRNA Antagomir

Sign In for Pricing
View Details