Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2A Fc, Rat (HEK293)

Ig gamma-2A chain C region (IgG2a) is one of the IgG antibodies subclasses and responses to an antigen. IgG2a plays a crucial role in the adaptive immune response[1][2]. IgG2A Fc Protein, Rat (HEK293) is the recombinant rat-derived IgG2A Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2A Fc Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2a-fc-protein-rat-hek-293.html

Purity

95.0

Smiles

VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK

Molecular Formula

679045 (Gene_ID) P20760 (V98-K322) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA6L4 Protein Vector (Human) (pPM-C-HA)
22382021 500 ng

GOLGA6L4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
BIRC8 Polyclonal Antibody
MBS9415981-01 0.1 mg

BIRC8 Polyclonal Antibody

Sign In for Pricing
View Details
BIRC8 Polyclonal Antibody
MBS9415981-02 5x 0.1 mg

BIRC8 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Spondin-1 (SPON1) ELISA Kit
MBS7212232-01 48 Well

Rat Spondin-1 (SPON1) ELISA Kit

Sign In for Pricing
View Details
Rat Spondin-1 (SPON1) ELISA Kit
MBS7212232-02 96 Well

Rat Spondin-1 (SPON1) ELISA Kit

Sign In for Pricing
View Details
Rat Spondin-1 (SPON1) ELISA Kit
MBS7212232-03 5x 96 Well

Rat Spondin-1 (SPON1) ELISA Kit

Sign In for Pricing
View Details