Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2A Fc, Rat (HEK293)

Ig gamma-2A chain C region (IgG2a) is one of the IgG antibodies subclasses and responses to an antigen. IgG2a plays a crucial role in the adaptive immune response[1][2]. IgG2A Fc Protein, Rat (HEK293) is the recombinant rat-derived IgG2A Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2A Fc Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2a-fc-protein-rat-hek-293.html

Purity

95.0

Smiles

VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK

Molecular Formula

679045 (Gene_ID) P20760 (V98-K322) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOSC2 (MARC2) (NM_017898) Human Recombinant Protein
TP303877 20 µg

MOSC2 (MARC2) (NM_017898) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae GRX6 Protein (aa 30-231) [His]
VAng-Wyb4727-1mg 1 mg

Recombinant Saccharomyces Cerevisiae GRX6 Protein (aa 30-231) [His]

Sign In for Pricing
View Details
MIEN1 Polyclonal Antibody
RD88238A-01 60 μL

MIEN1 Polyclonal Antibody

Sign In for Pricing
View Details
MIEN1 Polyclonal Antibody
RD88238A-02 120 μL

MIEN1 Polyclonal Antibody

Sign In for Pricing
View Details
MIEN1 Polyclonal Antibody
RD88238A-03 200 µL

MIEN1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal COX7A2L Antibody
NBP2-56202 100 µL

Rabbit Polyclonal COX7A2L Antibody

Sign In for Pricing
View Details