Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, N-His)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293, N-His) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, N-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek-293-his.html

Purity

95.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

42-47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CEPT1 shRNA Plasmid
abx979417-01 150 µg

Mouse CEPT1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CEPT1 shRNA Plasmid
abx979417-02 300 µg

Mouse CEPT1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal STRIP1 Antibody (OTI7B8) [mFluor Violet 500 SE]
NBP2-74408MFV500 0.1 mL

Mouse Monoclonal STRIP1 Antibody (OTI7B8) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Zp2 (NM_011775) Mouse Recombinant Protein
PM45212M5 20 µg

Zp2 (NM_011775) Mouse Recombinant Protein

Sign In for Pricing
View Details
DPM2 Human shRNA Plasmid Kit (Locus ID 8818)
TL319761 1 Kit

DPM2 Human shRNA Plasmid Kit (Locus ID 8818)

Sign In for Pricing
View Details
DDX3Y, NT (DDX3Y, DBY, ATP-dependent RNA helicase DDX3Y, DEAD box protein 3, Y-chromosomal) (Biotin) discontinued
034554-Biotin 200 µL

DDX3Y, NT (DDX3Y, DBY, ATP-dependent RNA helicase DDX3Y, DEAD box protein 3, Y-chromosomal) (Biotin) discontinued

Sign In for Pricing
View Details