Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, N-His)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293, N-His) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, N-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek-293-his.html

Purity

95.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

42-47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BHMT2 (NM_001178005) Human Tagged ORF Clone Lentiviral Particle
RC229850L3V 200 µL

BHMT2 (NM_001178005) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Mouse IL6 Protein, C-His
MY328012-01 50 µg

Recombinant Mouse IL6 Protein, C-His

Sign In for Pricing
View Details
Recombinant Mouse IL6 Protein, C-His
MY328012-02 100 µg

Recombinant Mouse IL6 Protein, C-His

Sign In for Pricing
View Details
Recombinant Mouse IL6 Protein, C-His
MY328012-03 1 mg

Recombinant Mouse IL6 Protein, C-His

Sign In for Pricing
View Details
Rabbit Polyclonal PNUTS/PPP1R10 Antibody [DyLight 755]
NB100-605IR 0.1 mL

Rabbit Polyclonal PNUTS/PPP1R10 Antibody [DyLight 755]

Sign In for Pricing
View Details
Mouse Monoclonal HDAC7 Antibody (PCRP-HDAC7-1B6)
NBP3-26705-100ug 100 µg

Mouse Monoclonal HDAC7 Antibody (PCRP-HDAC7-1B6)

Sign In for Pricing
View Details