Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293, N-His)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293, N-His) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293, N-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-hek-293-his.html

Purity

95.0

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

42-47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1500015O10Rik Recombinant Protein (Mouse)
RP109946 100 µg

1500015O10Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
SPEM1 sgRNA CRISPR Lentivector (Human) (Target 1)
K2271302 1.0 µg DNA

SPEM1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human NKAPL Protein
E30P12185 20 µg

Recombinant Human NKAPL Protein

Sign In for Pricing
View Details
RGD1566386 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
39442066 1.0 µg DNA

RGD1566386 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MSL3L1 Recombinant Protein Antigen
NBP1-87882PEP 0.1 mL

MSL3L1 Recombinant Protein Antigen

Sign In for Pricing
View Details
CSDE1 Protein Vector (Mouse) (pPM-C-HA)
PV168316 500 ng

CSDE1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details