Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Serum amyloid A protein (SAA1)

Product Specifications

Product Name Alternative

SAA

Abbreviation

Recombinant Sheep SAA1 protein

Gene Name

SAA1

UniProt

P42819

Expression Region

1-112aa

Organism

Ovis aries (Sheep)

Target Sequence

QWLSFLGEAYEGAKDMWRAYSDMREANFKGADKYFHARGNYDAAQRGPGGVWAAEVISNGREALQGITDPLFKGMTRDQVREDTKADQFANEWGRSGKDPNHFRPPGLPDKY

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Major acute phase reactant. Apolipoprotein of the HDL complex.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.7 kDa

References & Citations

"The primary structure of serum amyloid A protein in the sheep: comparison with serum amyloid A in other species." Syversen P.V., Juul J., Marhaug G., Husby G., Sletten K. Scand. J. Immunol. 39:88-94 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-100 1x 100 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-100 1x 100 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (G4E4), CF594 conjugate, 0.1mg/mL
BNC940855-100 1x 100 µL

Retinol Binding Protein-1 (G4E4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF488A conjugate, 0.1mg/mL
BNC880413-100 1x 100 µL

Chromogranin A (CHGA/413), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details