Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Serum amyloid A protein (SAA1)

Product Specifications

Product Name Alternative

SAA

Abbreviation

Recombinant Sheep SAA1 protein

Gene Name

SAA1

UniProt

P42819

Expression Region

1-112aa

Organism

Ovis aries (Sheep)

Target Sequence

QWLSFLGEAYEGAKDMWRAYSDMREANFKGADKYFHARGNYDAAQRGPGGVWAAEVISNGREALQGITDPLFKGMTRDQVREDTKADQFANEWGRSGKDPNHFRPPGLPDKY

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Major acute phase reactant. Apolipoprotein of the HDL complex.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.7 kDa

References & Citations

"The primary structure of serum amyloid A protein in the sheep: comparison with serum amyloid A in other species." Syversen P.V., Juul J., Marhaug G., Husby G., Sletten K. Scand. J. Immunol. 39:88-94 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTNAP5 Recombinant Protein Antigen
NBP2-55909PEP 100 µL

CNTNAP5 Recombinant Protein Antigen

Sign In for Pricing
View Details
Fmnl2 3'UTR GFP Stable Cell Line
TU156632 1.0 mL

Fmnl2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Collagen 1 alpha 1 Antibody
E38QA6598 100 µL

Collagen 1 alpha 1 Antibody

Sign In for Pricing
View Details
Rat Pannexin 1 (PANX1) ELISA Kit
EKU11764 96 Tests

Rat Pannexin 1 (PANX1) ELISA Kit

Sign In for Pricing
View Details
Human ZNF658 Pre-designed siRNA Set B
SI018979B 1 Each

Human ZNF658 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal MED23 Antibody [Alexa Fluor 405]
NB200-338AF405 0.1 mL

Rabbit Polyclonal MED23 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details