Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRA3/GDNFR-alpha-3, Human (HEK293, His)

GFRA3/GDNFR-alpha-3 Protein, as the receptor for glial cell line-derived neurotrophic factor ARTN, is crucial for mediating RET receptor tyrosine kinase autophosphorylation and activation upon artemin stimulation. Its interaction with SORL1 suggests involvement in diverse cellular signaling pathways. GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) is the recombinant human-derived GFRA3/GDNFR-alpha-3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfra3-gdnfr-alpha-3-protein-human-hek293-his.html

Purity

98.00

Smiles

DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNENPAVRPQPW

Molecular Formula

2676 (Gene_ID) O60609-1/NP_001487.2 (D32-W382) (Accession)

Molecular Weight

Approximately 50-57 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLenti-DSTYK shRNA-2
PPL00822-3c 1 Each

PLenti-DSTYK shRNA-2

Sign In for Pricing
View Details
2- (4-Amino-benzylidene) -1-aza-bicyclo[2.2.2]octan-3-one
sc-305396 500 mg

2- (4-Amino-benzylidene) -1-aza-bicyclo[2.2.2]octan-3-one

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri SPEA Polyclonal Antibody
MBS9000551 Inquire

Rabbit anti-Shigella flexneri SPEA Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Complement Component 5 (C5)
TRV-0062087-01 20 µL

Monoclonal Antibody to Complement Component 5 (C5)

Sign In for Pricing
View Details
Monoclonal Antibody to Complement Component 5 (C5)
TRV-0062087-02 100 µL

Monoclonal Antibody to Complement Component 5 (C5)

Sign In for Pricing
View Details
Monoclonal Antibody to Complement Component 5 (C5)
TRV-0062087-03 200 µL

Monoclonal Antibody to Complement Component 5 (C5)

Sign In for Pricing
View Details