Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Mouse (HEK293, His)

THSD1 protein actively regulates the assembly of nascent focal adhesions and affects the attachment of endothelial cells to the extracellular matrix. As a key player, THSD1 forms a complex with PTK2/FAK1, TLN1 and VCL and contributes to focal adhesion dynamics. THSD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived THSD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-mouse-hek293-his.html

Purity

97.50

Smiles

EYLLLQEPVHVALSDRTVSVGFHYLSDVNGTLRNVSVMLWEANTNRTLTTKYLLTNQAQGTLQFECFYFKEAGDYWFVMIPEVTDNGTQVPLWEKSAFLKVEWPVFHIDLNRTAKAAEGTFQVGVFTTQPLCLFPVDKPDMLVDVIFTDRLPEARASLGQPLEIRASKRTKLTQGQWVEFGCAPVGVEAYVTVMLRLLGQDSVIASTGPIDLAQKFGYKLMMAPEVTCESVLEVMVLPPPCVFVQGVLAVYKEAPKRPEERTFQVAENRLPLGERRTVFNCTLFDVGKNKYCFNFGIVKKGHFSAKECMLIQRNIETWGPWQPWSPCSTTCGDAVRERRRLCVTSFPSRPSCSGMSSETSPCSLEECAVFRPPGPSPVSPQDPVKSNN

Molecular Formula

56229 (Gene_ID) Q9JM61/NP_062522.1 (E25-N412) (Accession)

Molecular Weight

Approximately 60-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEL1L Human Gene Knockout Kit (CRISPR)
KN421999 1 Kit

SEL1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GDAP1L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G5]
TA503153BM 100 µL

GDAP1L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G5]

Sign In for Pricing
View Details
ITGB1BP1 Antibody
KC-2460-01 50 μL

ITGB1BP1 Antibody

Sign In for Pricing
View Details
ITGB1BP1 Antibody
KC-2460-02 100 µL

ITGB1BP1 Antibody

Sign In for Pricing
View Details
ITGB1BP1 Antibody
KC-2460-03 1 mL

ITGB1BP1 Antibody

Sign In for Pricing
View Details
Agtr1b Mouse Gene Knockout Kit (CRISPR)
KN501000 1 Kit

Agtr1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details