Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Mouse (HEK293, His)

THSD1 protein actively regulates the assembly of nascent focal adhesions and affects the attachment of endothelial cells to the extracellular matrix. As a key player, THSD1 forms a complex with PTK2/FAK1, TLN1 and VCL and contributes to focal adhesion dynamics. THSD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived THSD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-mouse-hek293-his.html

Purity

97.50

Smiles

EYLLLQEPVHVALSDRTVSVGFHYLSDVNGTLRNVSVMLWEANTNRTLTTKYLLTNQAQGTLQFECFYFKEAGDYWFVMIPEVTDNGTQVPLWEKSAFLKVEWPVFHIDLNRTAKAAEGTFQVGVFTTQPLCLFPVDKPDMLVDVIFTDRLPEARASLGQPLEIRASKRTKLTQGQWVEFGCAPVGVEAYVTVMLRLLGQDSVIASTGPIDLAQKFGYKLMMAPEVTCESVLEVMVLPPPCVFVQGVLAVYKEAPKRPEERTFQVAENRLPLGERRTVFNCTLFDVGKNKYCFNFGIVKKGHFSAKECMLIQRNIETWGPWQPWSPCSTTCGDAVRERRRLCVTSFPSRPSCSGMSSETSPCSLEECAVFRPPGPSPVSPQDPVKSNN

Molecular Formula

56229 (Gene_ID) Q9JM61/NP_062522.1 (E25-N412) (Accession)

Molecular Weight

Approximately 60-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR561577 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Human IGFBP2, C-His Tag
HA211103-01 20 µg

Human IGFBP2, C-His Tag

Sign In for Pricing
View Details
Human IGFBP2, C-His Tag
HA211103-02 50 µg

Human IGFBP2, C-His Tag

Sign In for Pricing
View Details
Human IGFBP2, C-His Tag
HA211103-03 100 µg

Human IGFBP2, C-His Tag

Sign In for Pricing
View Details
Phospho-STAT1 (Y701) Recombinant Rabbit monoclonal Antibody
HA750925 100 µL

Phospho-STAT1 (Y701) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Sdhd Mouse Gene Knockout Kit (CRISPR)
KN515435 1 Kit

Sdhd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details