Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Mouse (HEK293, His)

THSD1 protein actively regulates the assembly of nascent focal adhesions and affects the attachment of endothelial cells to the extracellular matrix. As a key player, THSD1 forms a complex with PTK2/FAK1, TLN1 and VCL and contributes to focal adhesion dynamics. THSD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived THSD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-mouse-hek293-his.html

Purity

97.50

Smiles

EYLLLQEPVHVALSDRTVSVGFHYLSDVNGTLRNVSVMLWEANTNRTLTTKYLLTNQAQGTLQFECFYFKEAGDYWFVMIPEVTDNGTQVPLWEKSAFLKVEWPVFHIDLNRTAKAAEGTFQVGVFTTQPLCLFPVDKPDMLVDVIFTDRLPEARASLGQPLEIRASKRTKLTQGQWVEFGCAPVGVEAYVTVMLRLLGQDSVIASTGPIDLAQKFGYKLMMAPEVTCESVLEVMVLPPPCVFVQGVLAVYKEAPKRPEERTFQVAENRLPLGERRTVFNCTLFDVGKNKYCFNFGIVKKGHFSAKECMLIQRNIETWGPWQPWSPCSTTCGDAVRERRRLCVTSFPSRPSCSGMSSETSPCSLEECAVFRPPGPSPVSPQDPVKSNN

Molecular Formula

56229 (Gene_ID) Q9JM61/NP_062522.1 (E25-N412) (Accession)

Molecular Weight

Approximately 60-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Meter™ Live Cell Caspase 9 Binding Assay Kit *Green Fluorescence*
20117-AAT 25 Tests

Cell Meter™ Live Cell Caspase 9 Binding Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details
Sez6 Mouse Gene Knockout Kit (CRISPR)
KN515636 1 Kit

Sez6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS632885 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human LYRM4 activation kit by CRISPRa
GA111393 1 Kit

Human LYRM4 activation kit by CRISPRa

Sign In for Pricing
View Details
CEMIP2 Human Gene Knockout Kit (CRISPR)
KN424793 1 Kit

CEMIP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NGLY1 Human Gene Knockout Kit (CRISPR)
KN203447RB 1 Kit

NGLY1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details