Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Mouse (HEK293, His)

THSD1 protein actively regulates the assembly of nascent focal adhesions and affects the attachment of endothelial cells to the extracellular matrix. As a key player, THSD1 forms a complex with PTK2/FAK1, TLN1 and VCL and contributes to focal adhesion dynamics. THSD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived THSD1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-mouse-hek293-his.html

Purity

97.50

Smiles

EYLLLQEPVHVALSDRTVSVGFHYLSDVNGTLRNVSVMLWEANTNRTLTTKYLLTNQAQGTLQFECFYFKEAGDYWFVMIPEVTDNGTQVPLWEKSAFLKVEWPVFHIDLNRTAKAAEGTFQVGVFTTQPLCLFPVDKPDMLVDVIFTDRLPEARASLGQPLEIRASKRTKLTQGQWVEFGCAPVGVEAYVTVMLRLLGQDSVIASTGPIDLAQKFGYKLMMAPEVTCESVLEVMVLPPPCVFVQGVLAVYKEAPKRPEERTFQVAENRLPLGERRTVFNCTLFDVGKNKYCFNFGIVKKGHFSAKECMLIQRNIETWGPWQPWSPCSTTCGDAVRERRRLCVTSFPSRPSCSGMSSETSPCSLEECAVFRPPGPSPVSPQDPVKSNN

Molecular Formula

56229 (Gene_ID) Q9JM61/NP_062522.1 (E25-N412) (Accession)

Molecular Weight

Approximately 60-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Dihydroxy-3-nitroanthraquinone
TRC-D454178-50MG 50 mg

1,2-Dihydroxy-3-nitroanthraquinone

Sign In for Pricing
View Details
TRPM7 Human Knockdown Lysate
LY300457 100 µg

TRPM7 Human Knockdown Lysate

Sign In for Pricing
View Details
Human ZFP2 activation kit by CRISPRa
GA112816 1 Kit

Human ZFP2 activation kit by CRISPRa

Sign In for Pricing
View Details
RUFY2 Human qPCR Primer Pair (NM_017987)
HP233250 200 Reactions

RUFY2 Human qPCR Primer Pair (NM_017987)

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF740 conjugate, 0.1mg/mL
BNC741224-500 1x 500 µL

HCG-beta (HCGb/54+ HCGb/459), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PECR Antibody
KC-3168-01 50 μL

PECR Antibody

Sign In for Pricing
View Details