Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus 14 kDa fusion protein (A27L)

Product Specifications

Product Name Alternative

A27L14 kDa fusion protein

Abbreviation

Recombinant Vaccinia virus A27L protein

Gene Name

A27L

UniProt

P20535

Expression Region

1-110aa

Organism

Vaccinia virus (strain Copenhagen) (VACV)

Target Sequence

MDGTLFPGDDDLAIPATEFFSTKADKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Structural protein involved in the envelopment of mature virion to form the wrapped virion. The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion movement within the infected cell. May play an indirect role in MV-cell fusion.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.6 kDa

References & Citations

"Appendix to 'The complete DNA sequence of vaccinia virus'." Goebel S.J., Johnson G.P., Perkus M.E., Davis S.W., Winslow J.P., Paoletti E. Virology 179:517-563 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fam221a shRNA (UAS) - Lentiviral mouse Fam221a shRNA (UAS) (25)
GTR15133781 1 Vial

Lentiviral mouse Fam221a shRNA (UAS) - Lentiviral mouse Fam221a shRNA (UAS) (25)

Sign In for Pricing
View Details
Rat prolactin,PRL ELISA Kit
CN-01969R2 48T

Rat prolactin,PRL ELISA Kit

Sign In for Pricing
View Details
Human TMPRSS11D shRNA Plasmid
abx956236-01 150 µg

Human TMPRSS11D shRNA Plasmid

Sign In for Pricing
View Details
Human TMPRSS11D shRNA Plasmid
abx956236-02 300 µg

Human TMPRSS11D shRNA Plasmid

Sign In for Pricing
View Details
PDF Antibody
MBS7104313-01 0.05 mg

PDF Antibody

Sign In for Pricing
View Details
PDF Antibody
MBS7104313-02 0.1 mg

PDF Antibody

Sign In for Pricing
View Details