Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNA, Human (His)

PITPNA Protein catalyzes phosphatidylinositol (PI) and phosphatidylcholine (PC) transfer between membranes, displaying a preference for shorter saturated or monosaturated acyl chains at sn-1 and sn-2 positions. For PC, the preference order is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, and for PI, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. PITPNA Protein, Human (His) is the recombinant human-derived PITPNA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PITPNA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pitpna-protein-human-his.html

Smiles

MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD

Molecular Formula

5306 (Gene_ID) Q00169 (M1-D270) (Accession)

Molecular Weight

Approximately 16 kDa & 22 kDa & 38 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK2 (MAP2K2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8G6]
TA500471AM 100 µL

MEK2 (MAP2K2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8G6]

Sign In for Pricing
View Details
Prolactin Receptor (B6.2), CF488A conjugate, 0.1mg/mL
BNC880741-500 1x 500 µL

Prolactin Receptor (B6.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AzoDye-1 Maleimide
2404-AAT 1 mg

AzoDye-1 Maleimide

Sign In for Pricing
View Details
Dihydroceramide
SIH-398-25MG 25 mg

Dihydroceramide

Sign In for Pricing
View Details
Taf1 Mouse Gene Knockout Kit (CRISPR)
KN517135 1 Kit

Taf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S-(5'-Adenosyl)-L-homocysteine-d4
TRC-A291501-2.5MG 2.5 mg

S-(5'-Adenosyl)-L-homocysteine-d4

Sign In for Pricing
View Details