Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 11 Protein E6 (E6)

Product Specifications

Product Name Alternative

Protein E6

Abbreviation

Recombinant Human papillomavirus 11 E6 protein

Gene Name

E6

UniProt

P04019

Expression Region

1-150aa

Organism

Human papillomavirus 11

Target Sequence

MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACACCLELQGKINQYRHFNYAAYAPTVEEETNEDILKVLIRCYLCHKPLCEIEKLKHILGKARFIKLNNQWKGRCLHCWTTCMEDLLP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Plays a major role in the induction and maintenance of cellular transformation. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase and modulates its activity. Sequesters tumor suppressor TP53 in the host cytoplasm and modulates its activity by interacting with host EP300 that results in the reduction of TP53 acetylation and activation. In turn, apoptosis induced by DNA damage is inhibited. E6 protects also host keratinocytes from apoptosis by mediating the degradation of host BAK1. May also inhibit host immune response.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.4 kDa

References & Citations

"E6 proteins from low-risk human papillomavirus types 6 and 11 are able to protect keratinocytes from apoptosis via Bak degradation." Underbrink M.P., Dupuis C., Wang J., Tyring S.K. J. Gen. Virol. 97:715-724 (2016)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSCAM (NM_001389) Human Over-expression Lysate
LC419962 20 µg

DSCAM (NM_001389) Human Over-expression Lysate

Sign In for Pricing
View Details
MACO1 (NM_001282564) Human Tagged ORF Clone
RG238229 10 µg

MACO1 (NM_001282564) Human Tagged ORF Clone

Sign In for Pricing
View Details
MTR1L Antibody
8G400-AAT 50 µg

MTR1L Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS625908 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
MMP3 Rabbit Polyclonal Antibody
AP13184PU-N 400 µL

MMP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Freeze Dryer BFBT-102-B
BFBT-102-B 1 Unit

Freeze Dryer BFBT-102-B

Sign In for Pricing
View Details