Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G1B, Mouse (HEK293, His)

The PLA2G1B protein is a secreted calcium-dependent phospholipase A2 that targets dietary phospholipids in the intestine.Phosphatidylethanolamine and phosphatidylglycerol are preferred, which hydrolyze the ester bond of the fatty acyl group at the sn-2 position.PLA2G1B Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G1B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLA2G1B Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g1b-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

AHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFC

Molecular Formula

18778 (Gene_ID) Q9Z0Y2 (A16-C146) (Accession)

Molecular Weight

Approximately 15.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAFG (NM_002359) Human Over-expression Lysate
LS004097 100 µg

MAFG (NM_002359) Human Over-expression Lysate

Sign In for Pricing
View Details
CCDC54 sgRNA CRISPR Lentivector (Human) (Target 3)
K0377104 1.0 µg DNA

CCDC54 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
AMG-25
orb1704855 2 mg

AMG-25

Sign In for Pricing
View Details
TentaGel® M NH2
M302002.1G 1 g

TentaGel® M NH2

Sign In for Pricing
View Details
Rabbit anti Mouse Interleukin-9:Preservative Free
MBS226200-01 0.1 mg

Rabbit anti Mouse Interleukin-9:Preservative Free

Sign In for Pricing
View Details
Rabbit anti Mouse Interleukin-9:Preservative Free
MBS226200-02 5x 0.1 mg

Rabbit anti Mouse Interleukin-9:Preservative Free

Sign In for Pricing
View Details