Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3D-CD3E Heterodimer, Human (HEK293, His)

CD3D protein is a component of the TCR-CD3 complex on T lymphocytes and plays a key role in adaptive immunity. It transmits signals through the CD3D, CD3E, CD3G, and CD3Z chains upon TCR engagement. CD3D-CD3E Heterodimer Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived CD3D-CD3E Heterodimer protein, expressed by HEK293 , with C-6*His labeled tag. CD3D-CD3E Heterodimer Protein, Human (HEK293, His), has molecular weight of 16-30 kDa.

Product Specifications

Product Name Alternative

CD3D-CD3E Heterodimer Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3d-cd3e-protein-human-hek-293-his.html

Purity

98.0

Smiles

FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA&DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Formula

915&916 (Gene_ID) P04234-1 (F22-A105) &P07766 (D23-D126) (Accession)

Molecular Weight

Approximately 28-38 kDa and 25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENOX1 Protein Vector (Mouse) (pPM-C-His)
PV175693 500 ng

ENOX1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ANO6 CRISPR/Cas9 KO Plasmid (h)
sc-402736 20 µg

ANO6 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Human Prolactin Recombinant Rabbit Monoclonal Antibody [PSH03-14] - BSA and Azide free (Detector)
HA721942 100 µL

Human Prolactin Recombinant Rabbit Monoclonal Antibody [PSH03-14] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Human PPP1CC protein
orb392320-01 10 µg

Human PPP1CC protein

Sign In for Pricing
View Details
Human PPP1CC protein
orb392320-02 50 µg

Human PPP1CC protein

Sign In for Pricing
View Details
Human PPP1CC protein
orb392320-03 500 µg

Human PPP1CC protein

Sign In for Pricing
View Details