Animal-Free I-TAC/CXCL11, Pig (His)
Selected Variant
HY-P700233AF
Size: 1 Each
I-TAC/CXCL11 Protein exhibits broad expression, notably in the lung (RPKM 3.0), mixtures (RPKM 2.0), and seven other tissues. This widespread distribution suggests its integral role in diverse physiological processes across different organ systems, underscoring the protein's significance in various biological contexts. Animal-Free I-TAC/CXCL11 Protein, Pig (His) is the recombinant pig-derived animal-FreeI-TAC/CXCL11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free I-TAC/CXCL11 Protein, Pig (His), Pig, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-i-tac-cxcl11-protein-pig-his.html
Smiles
FPMFKAGRCLCIGPGVKAVKVADIEKVSIIHPSNNCDKTEVIVTLKAHKGRRCLNPKSKQANVIMKKVERMNFLRYQNV
Molecular Formula
100169744 (Gene_ID) B3GDY9 (F22-V100) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Price
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Anti-MTUS1 Antibody Picoband®, PE Conjugate
Anti-FRA2/FOSL2 Antibody Picoband® (Biotine Conjugate)
Anti-IQGAP1 Antibody Picoband®, APC Conjugate
NRF1 (NRF1/2609), CF488A conjugate, 0.1mg/mL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), 1mg/mL
