Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein FAM3B (Fam3b)

Product Specifications

Product Name Alternative

Cytokine-like protein 2-21 Pancreatic-derived factor Short name: PANDER

Abbreviation

Recombinant Mouse Fam3b protein

Gene Name

Fam3b

UniProt

Q9D309

Expression Region

30-235aa

Organism

Mus musculus (Mouse)

Target Sequence

ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cytokine

Relevance

Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.4 kDa

References & Citations

"FAM3B PANDER and FAM3C ILEI Represent a Distinct Class of Signaling Molecules with a Non-Cytokine-like Fold." Johansson P., Bernstrom J., Gorman T., Oster L., Backstrom S., Schweikart F., Xu B., Xue Y., Schiavone L.H. Structure 21:306-313 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Galectin-7 (Gal-7) AssayLite™ Antibody (PerCP Conjugate)
30084-05171 5x 30 µg

Human Galectin-7 (Gal-7) AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)
MBS1135990-01 0.02 mg (E-Coli)

Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)
MBS1135990-02 0.02 mg (Yeast)

Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)
MBS1135990-03 0.1 mg (E-Coli)

Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)
MBS1135990-04 0.1 mg (Yeast)

Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)
MBS1135990-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas fluorescens Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details