Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP3, Human (His)

RBP3 Protein, or interphotoreceptor retinoid-binding protein (IRBP), crucially facilitates the transport of retinoids between retinol isomerase and visual pigments in the retina. Its role is essential for maintaining the visual pathway's integrity, ensuring proper synthesis and regeneration of visual pigments crucial for vision. RBP3 Protein, Human (His) is the recombinant human-derived RBP3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp3-protein-human-his.html

Purity

98.0

Smiles

TLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL

Molecular Formula

5949 (Gene_ID) P10745 (T321-L630) (Accession)

Molecular Weight

38&75-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2-Chloroethoxy)ethylphosphonic Acid
TRC-B406220-50MG 50 mg

2-(2-Chloroethoxy)ethylphosphonic Acid

Sign In for Pricing
View Details
S6K1 (RPS6KB1) Rabbit Polyclonal Antibody
AP02762PU-N 100 µL

S6K1 (RPS6KB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRIN1 Polyclonal Antibody
E-AB-68400-01 60 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
GRIN1 Polyclonal Antibody
E-AB-68400-02 120 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
GRIN1 Polyclonal Antibody
E-AB-68400-03 200 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
Human DPP9 activation kit by CRISPRa
GA114081 1 Kit

Human DPP9 activation kit by CRISPRa

Sign In for Pricing
View Details