Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF2 Antibody

KLF2 Antibody

Product Specifications

Product Name Alternative

KLF2, Krueppel-like factor 2, Kruppel-like factor LKLF, Kruppel-like factor 2 (lung), Lung krueppel-like factor, LKLF

Reactivity

Mouse

Immunogen

Synthetic peptide from N-Terminus of mouse Klf2 (Q60843, NP_032478) within the region MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM. Percent identity by BLAST analysis: Mouse, Zebra finch, Chicken (100%) ; Marmoset, Rat, Opossum (92%) ; Human, Gibbon, Galago, Pig (85%) ; Xenopus (83%) .

Target

KLF2

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Cancer Biology

Purification

Immunoaffinity purified

Concentration

0.5 mg/ml

Dilution

IHC, IHC-P (5 μg/ml), WB (0.2 - 1 μg/ml)

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

Further information: Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as secondary antibody.

Tested Applications

IHC, IHC-P, WB

Host or Source

Rabbit

Preservative

PBS, 0.09% sodium azide, 2% sucrose

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP1 (Forkhead Box P1, 12CC4, 3110052D19Rik, 4932443N09Rik, AI461938, AW494214, FLJ23741, hFKH1B, Glutamine Rich Factor 1, HSPC215, MGC12942, MGC88572, MGC99551, QRF1) (HRP)
MBS6250885-01 0.1 mL

FOXP1 (Forkhead Box P1, 12CC4, 3110052D19Rik, 4932443N09Rik, AI461938, AW494214, FLJ23741, hFKH1B, Glutamine Rich Factor 1, HSPC215, MGC12942, MGC88572, MGC99551, QRF1) (HRP)

Sign In for Pricing
View Details
FOXP1 (Forkhead Box P1, 12CC4, 3110052D19Rik, 4932443N09Rik, AI461938, AW494214, FLJ23741, hFKH1B, Glutamine Rich Factor 1, HSPC215, MGC12942, MGC88572, MGC99551, QRF1) (HRP)
MBS6250885-02 5x 0.1 mL

FOXP1 (Forkhead Box P1, 12CC4, 3110052D19Rik, 4932443N09Rik, AI461938, AW494214, FLJ23741, hFKH1B, Glutamine Rich Factor 1, HSPC215, MGC12942, MGC88572, MGC99551, QRF1) (HRP)

Sign In for Pricing
View Details
Lentiviral human PNMA6A shRNA (UAS) - Lentiviral human PNMA6A shRNA (UAS, GFP) (25)
GTR15323795 1 Vial

Lentiviral human PNMA6A shRNA (UAS) - Lentiviral human PNMA6A shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Serpinb3c Protein Vector (Mouse) (pPM-C-His)
PV228137 500 ng

Serpinb3c Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (MaxLight 550)
128122-ML550 100 µL

HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (MaxLight 550)

Sign In for Pricing
View Details
Gamborg’s B-5 Medium w/o Sucrose (Powder) discontinued see 299646
G1045-01 10 L

Gamborg’s B-5 Medium w/o Sucrose (Powder) discontinued see 299646

Sign In for Pricing
View Details