Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTK1, Human (GST)

The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB) . active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. GSTK1 Protein, Human (GST) is the recombinant human-derived Glutathione S-transferase kappa 1/GSTK1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

GSTK1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glutathione-s-transferase-kappa-1-gstk1-protein-human-gst.html

Smiles

GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

Molecular Formula

373156 (Gene_ID) Q9Y2Q3-1 (G2-L226) (Accession)

Molecular Weight

52.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-100 1x 100 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006), CF640R conjugate, 0.1mg/mL
BNC400006-100 1x 100 µL

Bcl-x (BX006), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF640R conjugate, 0.1mg/mL
BNC400743-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details