Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Rat (HEK293, His)

RBP4 Protein transports retinol in blood plasma, delivering it from the liver to peripheral tissues. It binds to all-trans retinol, transferring it to STRA6 for cell membrane transport. RBP4 interacts with TTR, preventing kidney filtration, and further aids STRA6 in retinol transport. RBP4 Protein, Rat (HEK293, His) is the recombinant rat-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-rat-hek293-his.html

Purity

98.0

Smiles

ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLTPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Molecular Formula

25703 (Gene_ID) P04916 (E19-L201) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human BNIP1 pAb
PA15549-01 50 μL

Rabbit Anti-Human BNIP1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human BNIP1 pAb
PA15549-02 100 μL

Rabbit Anti-Human BNIP1 pAb

Sign In for Pricing
View Details
Rabbit anti-SHPTP2 Antibody
YLD7173-01 50 µL

Rabbit anti-SHPTP2 Antibody

Sign In for Pricing
View Details
Rabbit anti-SHPTP2 Antibody
YLD7173-02 100 µL

Rabbit anti-SHPTP2 Antibody

Sign In for Pricing
View Details
Phospho-ERBB2 (Y1139) Recombinant Monoclonal Antibody [10G9]
A73976-050 50 µL

Phospho-ERBB2 (Y1139) Recombinant Monoclonal Antibody [10G9]

Sign In for Pricing
View Details
Pde4d antibody - N-terminal region (ARP56672_P050)
ARP56672_P050 100 µL

Pde4d antibody - N-terminal region (ARP56672_P050)

Sign In for Pricing
View Details