Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF-1 alpha/CXCL12, Mouse (68a.a, CHO)

SDF-1 alpha (Stromal Cell-Derived Factor-1α, SDF-1α) is a member of the chemokine α subfamily that lack the ELR domain. SDF-1α works as a chemoattractant for T- and B-lymphocytes and monocytes. SDF-1α is a ligand for CXCR4. The SDF-1α/CXCR4 signaling mediates many physiological processes including cell trafficking, angiogenesis, embryogenesis, tumor invasion and metastatic. It also controls the chemotaxis of hematopoietic stem cells homing to the bone marrow[1][2]. SDF-1 alpha/CXCL12 Protein, Mouse (CHO) is produced in CHO cells.

Product Specifications

Product Name Alternative

SDF-1 alpha/CXCL12 Protein, Mouse (68a.a, CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sdf-1-alpha-cxcl12-protein-mouse-68a-a-cho.html

Purity

95.00

Smiles

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Formula

20315 (Gene_ID) P40224-1 (K22-K89) (Accession)

Molecular Weight

Approximately 8 kDa

References & Citations

[1]Kryczek I, et al. Stroma-derived factor (SDF-1/CXCL12) and human tumor pathogenesis. Am J Physiol Cell Physiol. 2007 Mar;292 (3) :C987-95.|[2]Santhosh K Ghadge, et al. SDF-1α as a therapeutic stem cell homing factor in myocardial infarction. Pharmacol Ther. 2011 Jan;129 (1) :97-108.|[3]Zheng Jiang, et al. Contribution of SDF-1α/CXCR4 signaling to brain development and glioma progression. Neurosignals. 2013;21 (3-4) :240-58.|[4]Zhiqiang Meng, et al. SDF Factor-1α Promotes the Migration, Proliferation, and Osteogenic Differentiation of Mouse Bone Marrow Mesenchymal Stem Cells Through the Wnt/β-Catenin Pathway. Stem Cells Dev. 2021 Jan 15;30 (2) :106-117.|[5]Yonghui Dong, et al. Inhibition of SDF-1α/CXCR4 Signalling in Subchondral Bone Attenuates Post-Traumatic Osteoarthritis. Int J Mol Sci. 2016 Jun 16;17 (6) :943.|[6]Ge Zhang, et al. Controlled release of stromal cell-derived factor-1 alpha in situ increases c-kit+ cell homing to the infarcted heart. Tissue Eng. 2007 Aug;13 (8) :2063-71.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CABC1, CT (D531) (Chaperone-activity of BC1 Complex-like, Mitochondrial, Chaperone-ABC1-like, aarF Domain-containing Protein Kinase 3, ADCK3, PP265) (Biotin)
MBS6466296-01 0.2 mL

CABC1, CT (D531) (Chaperone-activity of BC1 Complex-like, Mitochondrial, Chaperone-ABC1-like, aarF Domain-containing Protein Kinase 3, ADCK3, PP265) (Biotin)

Ask
View Details
CABC1, CT (D531) (Chaperone-activity of BC1 Complex-like, Mitochondrial, Chaperone-ABC1-like, aarF Domain-containing Protein Kinase 3, ADCK3, PP265) (Biotin)
MBS6466296-02 5x 0.2 mL

CABC1, CT (D531) (Chaperone-activity of BC1 Complex-like, Mitochondrial, Chaperone-ABC1-like, aarF Domain-containing Protein Kinase 3, ADCK3, PP265) (Biotin)

Ask
View Details
Biotin-Linked Antibody to Protein Disulfide Isomerase (PDI)
MBS2002497-01 0.1 mL

Biotin-Linked Antibody to Protein Disulfide Isomerase (PDI)

Ask
View Details
Biotin-Linked Antibody to Protein Disulfide Isomerase (PDI)
MBS2002497-02 0.2 mL

Biotin-Linked Antibody to Protein Disulfide Isomerase (PDI)

Ask
View Details
Biotin-Linked Antibody to Protein Disulfide Isomerase (PDI)
MBS2002497-03 0.5 mL

Biotin-Linked Antibody to Protein Disulfide Isomerase (PDI)

Ask
View Details
Biotin-Linked Antibody to Protein Disulfide Isomerase (PDI)
MBS2002497-04 1 mL

Biotin-Linked Antibody to Protein Disulfide Isomerase (PDI)

Ask
View Details