Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial

Product Specifications

Product Name Alternative

(BTL-II)

Abbreviation

Recombinant Human BTNL2 protein, partial

Gene Name

BTNL2

UniProt

Q9UIR0

Expression Region

24-455aa

Organism

Homo sapiens (Human)

Target Sequence

KQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Negative regulator of T-cell proliferation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

74.1 kDa

References & Citations

"Sarcoidosis is associated with a truncating splice site mutation in BTNL2." Valentonyte R., Hampe J., Huse K., Rosenstiel P., Albrecht M., Stenzel A., Nagy M., Gaede K.I., Franke A., Haesler R., Koch A., Lengauer T., Seegert D., Reiling N., Ehlers S., Schwinger E., Platzer M., Krawczak M. Schreiber S. Nat. Genet. 37:357-364 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Q9UIR0-1

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (COL-1 + CEA31 + C66/261), CF568 conjugate, 0.1mg/mL
BNC680747-100 1x 100 µL

CD66 (CEA) (COL-1 + CEA31 + C66/261), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF647 conjugate, 0.1mg/mL
BNC472453-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details