Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pappalysin 2 (PAPPA2) ELISA Kit
RD-PAPPA2-Hu-01 96 Tests

Human Pappalysin 2 (PAPPA2) ELISA Kit

Sign In for Pricing
View Details
Human Pappalysin 2 (PAPPA2) ELISA Kit
RD-PAPPA2-Hu-02 48 Tests

Human Pappalysin 2 (PAPPA2) ELISA Kit

Sign In for Pricing
View Details
C14orf109 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0302308 1.0 µg DNA

C14orf109 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Slfn14-ps sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3031805 3x 1.0 µg

Slfn14-ps sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Hspbap1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7037003 1.0 µg DNA

Hspbap1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human OR4E2 Knockout A549 cell line
GTR15415910 1 Vial

Human OR4E2 Knockout A549 cell line

Sign In for Pricing
View Details