Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Novyi rpmB Protein (aa 1-63)
VAng-Lsx00131-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Novyi rpmB Protein (aa 1-63)

Sign In for Pricing
View Details
Tapbp ORF Vector (Mouse) (pORF)
ORF059075 1.0 µg DNA

Tapbp ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RIP (RIPK1) (C-term) rabbit polyclonal antibody
AP23530PU-N 50 µg

RIP (RIPK1) (C-term) rabbit polyclonal antibody

Sign In for Pricing
View Details
CD4 (NM_001195017) Human Tagged ORF Clone
RC233385 10 µg

CD4 (NM_001195017) Human Tagged ORF Clone

Sign In for Pricing
View Details
TRAF3 CRISPRa sgRNA lentivector (set of three targets)(Human)
47430121 3x 1.0µg DNA

TRAF3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TRIM11, CT (TRIM11, RNF92, E3 ubiquitin-protein ligase TRIM11, Protein BIA1, RING finger protein 92, Tripartite motif-containing protein 11) (MaxLight 650)
MBS6358140-01 0.1 mL

TRIM11, CT (TRIM11, RNF92, E3 ubiquitin-protein ligase TRIM11, Protein BIA1, RING finger protein 92, Tripartite motif-containing protein 11) (MaxLight 650)

Sign In for Pricing
View Details