Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ESR1 (S106) Antibody
A21336-50UG 50 µg

Phospho-ESR1 (S106) Antibody

Sign In for Pricing
View Details
JPH2 siRNA (Mouse)
MBS8232483-01 15 nmol

JPH2 siRNA (Mouse)

Sign In for Pricing
View Details
JPH2 siRNA (Mouse)
MBS8232483-02 30 nmol

JPH2 siRNA (Mouse)

Sign In for Pricing
View Details
JPH2 siRNA (Mouse)
MBS8232483-03 5x 30 nmol

JPH2 siRNA (Mouse)

Sign In for Pricing
View Details
DFNA30 Protein Vector (Human) (pPM-C-His)
PV072892 500 ng

DFNA30 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PLD1 Human Pre-designed siRNA Set A
HY-RS10670 1 Set

PLD1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details