Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP12 (NM_013437) Human Tagged ORF Clone
RG204847 10 µg

LRP12 (NM_013437) Human Tagged ORF Clone

Sign In for Pricing
View Details
HN1 (JPT1) (NM_016185) Human Tagged Lenti ORF Clone
RC221865L4 10 µg

HN1 (JPT1) (NM_016185) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human T-cell acute lymphoblastic leukemia Anti-gen (TALLA-1) ELISA Kit
NSL0246Hu 96 Tests

Human T-cell acute lymphoblastic leukemia Anti-gen (TALLA-1) ELISA Kit

Sign In for Pricing
View Details
Salicylic acid p.A.
LC-7366.2 1 Kg

Salicylic acid p.A.

Sign In for Pricing
View Details
SD-208 2mg
A14066-2 2 mg

SD-208 2mg

Sign In for Pricing
View Details
Rat Fbxl18 Pre-designed siRNA Set B
SI204917B 1 Each

Rat Fbxl18 Pre-designed siRNA Set B

Sign In for Pricing
View Details