Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipopolysaccharides (LPS) ELISA Kit
abx585153-01 96 Tests

Lipopolysaccharides (LPS) ELISA Kit

Sign In for Pricing
View Details
Lipopolysaccharides (LPS) ELISA Kit
abx585153-02 5x 96 Tests

Lipopolysaccharides (LPS) ELISA Kit

Sign In for Pricing
View Details
Lipopolysaccharides (LPS) ELISA Kit
abx585153-03 10x 96 Tests

Lipopolysaccharides (LPS) ELISA Kit

Sign In for Pricing
View Details
Protein C-ets-2 (ETS2) Chicken ELISA Kit
G2511 96 Tests

Protein C-ets-2 (ETS2) Chicken ELISA Kit

Sign In for Pricing
View Details
CABP7, 1-188aa, Human, His tag, E.coli
E53A01397 50 µg

CABP7, 1-188aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Atp6v1h Rat shRNA Lentiviral Particle (Locus ID 297797)
TL702065V 500 µL Each

Atp6v1h Rat shRNA Lentiviral Particle (Locus ID 297797)

Sign In for Pricing
View Details