Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Killer cell immunoglobulin-Like Receptor 2DL3 (KIR2DL3) Human ELISA Kit
E5307 96 Tests

Killer cell immunoglobulin-Like Receptor 2DL3 (KIR2DL3) Human ELISA Kit

Sign In for Pricing
View Details
5830418K08Rik Protein Vector (Mouse) (pPB-N-His)
PV150059 500 ng

5830418K08Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit anti-Aspergillus oryzae (strain 42149/RIB 40)(Yellow koji mold) glaA Polyclonal Antibody
MBS7158338 Inquire

Rabbit anti-Aspergillus oryzae (strain 42149/RIB 40)(Yellow koji mold) glaA Polyclonal Antibody

Sign In for Pricing
View Details
Trmt2a (NM_001081000) Mouse Tagged Lenti ORF Clone
MR209324L4 10 µg

Trmt2a (NM_001081000) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FOXL1 (Forkhead Box L1, FKH6, FKHL11, FREAC7) (MaxLight 490)
246290-ML490 100 µL

FOXL1 (Forkhead Box L1, FKH6, FKHL11, FREAC7) (MaxLight 490)

Sign In for Pricing
View Details
Leukotriene C4 Synthase, NT (Leukotriene-C(4) Synthase, LTC4 Synthase, LTC4S, MGC33147) (PE)
MBS6485036-01 0.2 mL

Leukotriene C4 Synthase, NT (Leukotriene-C(4) Synthase, LTC4 Synthase, LTC4S, MGC33147) (PE)

Sign In for Pricing
View Details