Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBL2 (NM_012453) Human Tagged ORF Clone Lentiviral Particle
RC211405L3V 200 µL

TBL2 (NM_012453) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ASPIRATION MANIFOLD, 12 Channel, 12 Well, Deep Well Plate, 19 Gauge, Stainless Steel Tubes, 60mm Long, 9mm Center Spacing, Polypropylene, Female Luer Lok
VP 187BP-60 1 EACH

ASPIRATION MANIFOLD, 12 Channel, 12 Well, Deep Well Plate, 19 Gauge, Stainless Steel Tubes, 60mm Long, 9mm Center Spacing, Polypropylene, Female Luer Lok

Sign In for Pricing
View Details
Rat Armh1 Pre-designed siRNA Set A
SI200955A 1 Each

Rat Armh1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
APC/Fire™ 750 anti-mouse CD186 (CXCR6)
GT05354 25 µg

APC/Fire™ 750 anti-mouse CD186 (CXCR6)

Sign In for Pricing
View Details
Glutamine PRPP amidotransferase Antibody, FITC Conjugated
bs-6359R-FITC 100 µL

Glutamine PRPP amidotransferase Antibody, FITC Conjugated

Sign In for Pricing
View Details
pCMV-SPORT6-HOXA11 Plasmid
PVT19860 2 µg

pCMV-SPORT6-HOXA11 Plasmid

Sign In for Pricing
View Details