Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Polyclonal Sheep anti-Rat IgG (H+L) Secondary Antibody [PerCP]
NB120-6847PCP 0.5 mL

Sheep Polyclonal Sheep anti-Rat IgG (H+L) Secondary Antibody [PerCP]

Sign In for Pricing
View Details
Anti-IGFL2 antibody
STJ191867 200 µl

Anti-IGFL2 antibody

Sign In for Pricing
View Details
Mouse Monoclonal CMP kinase Antibody (OTI1A1) [Alexa Fluor 594]
NBP2-71947AF594 0.1 mL

Mouse Monoclonal CMP kinase Antibody (OTI1A1) [Alexa Fluor 594]

Sign In for Pricing
View Details
ApoER2 discontinued
533147-01 30ul

ApoER2 discontinued

Sign In for Pricing
View Details
ApoER2 discontinued
533147-02 100 µL

ApoER2 discontinued

Sign In for Pricing
View Details
ZFYVE19 (NM_001258421) Human Tagged ORF Clone
RG233685 10 µg

ZFYVE19 (NM_001258421) Human Tagged ORF Clone

Sign In for Pricing
View Details