Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-mmu-miR-409-3p Vector
mm40756 500 ng

LentimiRa-mmu-miR-409-3p Vector

Sign In for Pricing
View Details
Tcte2 Recombinant Protein (Mouse)
RP177971 100 µg

Tcte2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Connexin 37, 40, GAP26, Scrambled Peptides (37,40Cx-Gap26)
C7855-42A 1 mg

Connexin 37, 40, GAP26, Scrambled Peptides (37,40Cx-Gap26)

Sign In for Pricing
View Details
Recombinant Mouse MAN2B2 Protein, His (Fc)-Avi-tagged
MAN2B2-5317M 50 µg

Recombinant Mouse MAN2B2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Monoclonal PAG1 Antibody (C-Terminus, clone PAG-C1), Clone: PAG-C1
APR17741G 0.05mg

Monoclonal PAG1 Antibody (C-Terminus, clone PAG-C1), Clone: PAG-C1

Sign In for Pricing
View Details
CKAP2 (Cytoskeleton Associated Protein 2, DKFZp686L1238, FLJ10749, LB1, TMAP, se20-10)
244715 100 µg

CKAP2 (Cytoskeleton Associated Protein 2, DKFZp686L1238, FLJ10749, LB1, TMAP, se20-10)

Sign In for Pricing
View Details