Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anaphase-Promoting Complex Subunit 11 (ANAPC11) ELISA Kit
MBS9934281 Inquire

Rabbit Anaphase-Promoting Complex Subunit 11 (ANAPC11) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human SENP3 sgRNA gene knockout kit - Lentiviral human SENP3 sgRNA gene knockout kit (25)
GTR15396666 1 Vial

Lentiviral human SENP3 sgRNA gene knockout kit - Lentiviral human SENP3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Progesterone Receptor (PGR) Rabbit Polyclonal Antibody
TA325778 100 µL

Progesterone Receptor (PGR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Me3 shRNA (UAS) - Lentiviral mouse Me3 shRNA (UAS, iRFP) plasmid
GTR15179596 1 Vial

Lentiviral mouse Me3 shRNA (UAS) - Lentiviral mouse Me3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Anti-Cytochrome P450 7A1 Antibody
CQA4201-01 30 µL

Anti-Cytochrome P450 7A1 Antibody

Sign In for Pricing
View Details
Anti-Cytochrome P450 7A1 Antibody
CQA4201-02 50 μL

Anti-Cytochrome P450 7A1 Antibody

Sign In for Pricing
View Details