Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EVPL Protein Vector (Rat) (pPB-C-His)
PV266746 500 ng

EVPL Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Human Glutamine and serine-rich protein 1 (QSER1) ELISA Kit
AE24847HU-01 48 Tests

Human Glutamine and serine-rich protein 1 (QSER1) ELISA Kit

Sign In for Pricing
View Details
Human Glutamine and serine-rich protein 1 (QSER1) ELISA Kit
AE24847HU-02 96 Tests

Human Glutamine and serine-rich protein 1 (QSER1) ELISA Kit

Sign In for Pricing
View Details
ZNF334 ORF Vector (Human) (pORF)
51456011 1.0 µg DNA

ZNF334 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
OSBPL1A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV671409 1.0 µg DNA

OSBPL1A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
TUBA6 (TUBA1C) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D8]
TA506685BM 100 µL

TUBA6 (TUBA1C) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D8]

Sign In for Pricing
View Details