Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf52 sgRNA CRISPR Lentivector set (Human)
K0329701 3x 1.0 µg

C19orf52 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MST1 Matched ELISA Antibody Pair Set, Human
MBS8118379-01 5 Plates

MST1 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
MST1 Matched ELISA Antibody Pair Set, Human
MBS8118379-02 15 Plates

MST1 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
MST1 Matched ELISA Antibody Pair Set, Human
MBS8118379-03 5x 15 Plates

MST1 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
Guinea Pig Big ET ELISA Kit
EGB0669 96 Tests

Guinea Pig Big ET ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein C-IV Protein, His, Yeast-500ug
QP8992-ye-500ug 500ug

Recombinant Human Apolipoprotein C-IV Protein, His, Yeast-500ug

Sign In for Pricing
View Details