Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CANT1, NT (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY)
MBS630047-01 0.2 mL

CANT1, NT (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY)

Sign In for Pricing
View Details
CANT1, NT (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY)
MBS630047-02 5x 0.2 mL

CANT1, NT (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY)

Sign In for Pricing
View Details
Mouse Monoclonal CD53 Antibody (425514) [DyLight 550]
FAB4624L 0.1 mL

Mouse Monoclonal CD53 Antibody (425514) [DyLight 550]

Sign In for Pricing
View Details
7-Deaza-7-propargylamino-dATP (tetralithium)
HY-132143A 1 Each

7-Deaza-7-propargylamino-dATP (tetralithium)

Sign In for Pricing
View Details
Oat Mouse shRNA Plasmid (Locus ID 18242)
TR501524 1 Kit

Oat Mouse shRNA Plasmid (Locus ID 18242)

Sign In for Pricing
View Details
ZNF268 Human qPCR Primer Pair (NM_003415)
HP206937 200 Reactions

ZNF268 Human qPCR Primer Pair (NM_003415)

Sign In for Pricing
View Details