Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit
MBS2567369-01 24 Tests

Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit

Sign In for Pricing
View Details
Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit
MBS2567369-02 48 Test

Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit

Sign In for Pricing
View Details
Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit
MBS2567369-03 96 Tests

Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit

Sign In for Pricing
View Details
Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit
MBS2567369-04 5x 96 Tests

Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit

Sign In for Pricing
View Details
Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit
MBS2567369-05 10x 96 Tests

Human VE-Cadherin (Vascular Endothelial Cadherin) ELISA Kit

Sign In for Pricing
View Details
IFI16 sgRNA CRISPR Lentivector (Human) (Target 2)
K1016603 1.0 µg DNA

IFI16 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details