Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM3A Protein Vector (Human) (pPB-C-His)
PV015365 500 ng

FAM3A Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
TAOK3 (TAO Kinase 3, DKFZp666H245, DPK, FLJ31808, JIK, MAP3K18) (MaxLight 490)
MBS6208855-01 0.1 mL

TAOK3 (TAO Kinase 3, DKFZp666H245, DPK, FLJ31808, JIK, MAP3K18) (MaxLight 490)

Sign In for Pricing
View Details
TAOK3 (TAO Kinase 3, DKFZp666H245, DPK, FLJ31808, JIK, MAP3K18) (MaxLight 490)
MBS6208855-02 5x 0.1 mL

TAOK3 (TAO Kinase 3, DKFZp666H245, DPK, FLJ31808, JIK, MAP3K18) (MaxLight 490)

Sign In for Pricing
View Details
Noelin-3 (OLFM3) Rat ELISA Kit
F4169 96 Tests

Noelin-3 (OLFM3) Rat ELISA Kit

Sign In for Pricing
View Details
Alb sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4366102 1.0 µg DNA

Alb sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-124-5p Virus
mh1562 250 µL

AdmiRa-hsa-miR-124-5p Virus

Sign In for Pricing
View Details