Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUHW1 (ZNF280A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]
TA800173BM 100 µL

SUHW1 (ZNF280A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]

Sign In for Pricing
View Details
DUX4L16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV723479 1.0 µg DNA

DUX4L16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila panD Protein (aa 1-25) (strain Paris)
VAng-Lsx04089-50gEcoli 50 µg (E. coli)

Recombinant Legionella Pneumophila panD Protein (aa 1-25) (strain Paris)

Sign In for Pricing
View Details
Mouse Monoclonal alpha-Fetoprotein/AFP Antibody (SPM334) [mFluor Violet 500 SE]
NBP2-37754MFV500 0.1 mL

Mouse Monoclonal alpha-Fetoprotein/AFP Antibody (SPM334) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
TADA1 AAV Vector (Human) (CMV)
46060101 1 µg

TADA1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human WHAMM Pre-designed siRNA Set A
SI018248A 1 Each

Human WHAMM Pre-designed siRNA Set A

Sign In for Pricing
View Details