Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL36P5 3'UTR Luciferase Stable Cell Line
TU021522 1.0 mL

RPL36P5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LAMA2 (Laminin, alpha 2, LAMM) (MaxLight 750) discontinued
248059-ML750 100 µL

LAMA2 (Laminin, alpha 2, LAMM) (MaxLight 750) discontinued

Sign In for Pricing
View Details
BIRC3, NT (BIRC3, API2, IAP1, MIHC, RNF49, Baculoviral IAP repeat-containing protein 3, Apoptosis inhibitor 2, C-IAP2, IAP homolog C, Inhibitor of apoptosis protein 1, RING finger protein 49, TNFR2-TRAF-signaling complex protein 1) (MaxLight 405)
MBS6278455-01 0.1 mL

BIRC3, NT (BIRC3, API2, IAP1, MIHC, RNF49, Baculoviral IAP repeat-containing protein 3, Apoptosis inhibitor 2, C-IAP2, IAP homolog C, Inhibitor of apoptosis protein 1, RING finger protein 49, TNFR2-TRAF-signaling complex protein 1) (MaxLight 405)

Sign In for Pricing
View Details
BIRC3, NT (BIRC3, API2, IAP1, MIHC, RNF49, Baculoviral IAP repeat-containing protein 3, Apoptosis inhibitor 2, C-IAP2, IAP homolog C, Inhibitor of apoptosis protein 1, RING finger protein 49, TNFR2-TRAF-signaling complex protein 1) (MaxLight 405)
MBS6278455-02 5x 0.1 mL

BIRC3, NT (BIRC3, API2, IAP1, MIHC, RNF49, Baculoviral IAP repeat-containing protein 3, Apoptosis inhibitor 2, C-IAP2, IAP homolog C, Inhibitor of apoptosis protein 1, RING finger protein 49, TNFR2-TRAF-signaling complex protein 1) (MaxLight 405)

Sign In for Pricing
View Details
Rat SELP ELISA Kit
EF017075 96 Tests

Rat SELP ELISA Kit

Sign In for Pricing
View Details
Prasugrel (Maleic acid) 10mg
A21832-10 10 mg

Prasugrel (Maleic acid) 10mg

Sign In for Pricing
View Details