Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFE2L1 Antibody, FITC conjugated
A29664-100UG 100 µg

NFE2L1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Lentiviral human DMAC2L shRNA (UAS) - Lentiviral human DMAC2L shRNA (UAS) (25)
GTR15118649 1 Vial

Lentiviral human DMAC2L shRNA (UAS) - Lentiviral human DMAC2L shRNA (UAS) (25)

Sign In for Pricing
View Details
UCP4 Antibody
E51A11533 100 µL

UCP4 Antibody

Sign In for Pricing
View Details
ADRA1B, ID (ADRA1B, Alpha-1B adrenergic receptor, Alpha-1B adrenoreceptor) (MaxLight 405) discontinued
031659-ML405 100 µL

ADRA1B, ID (ADRA1B, Alpha-1B adrenergic receptor, Alpha-1B adrenoreceptor) (MaxLight 405) discontinued

Sign In for Pricing
View Details
NOV/CCN3 Recombinant Protein Antigen
NBP1-88155PEP 0.1 mL

NOV/CCN3 Recombinant Protein Antigen

Sign In for Pricing
View Details
PTGER2, ID (Prostanoid EP2 Receptor, Prostaglandin E2 Receptor EP2 Subtype, PGE2 Receptor EP2 Subtype, PGE Receptor EP2 Subtype) (APC)
MBS6494755-01 0.2 mL

PTGER2, ID (Prostanoid EP2 Receptor, Prostaglandin E2 Receptor EP2 Subtype, PGE2 Receptor EP2 Subtype, PGE Receptor EP2 Subtype) (APC)

Sign In for Pricing
View Details