Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (Biotinylated, HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-biotinylated-hek293-his-avi.html

Purity

95.0

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

48-62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Darexaban maleate
MBS5811902 Inquire

Darexaban maleate

Sign In for Pricing
View Details
Rafoxanide-13C6
TRC-R073502-5MG 5 mg

Rafoxanide-13C6

Sign In for Pricing
View Details
Rat WS Brain, whole Total Protein
RT-201-WS 1 mg

Rat WS Brain, whole Total Protein

Sign In for Pricing
View Details
Boric Acid, Pinacol Ester
TRC-B675408-50MG 50 mg

Boric Acid, Pinacol Ester

Sign In for Pricing
View Details
Fastkd2 Rat shRNA Plasmid (Locus ID 301463)
TL701324 1 Kit

Fastkd2 Rat shRNA Plasmid (Locus ID 301463)

Sign In for Pricing
View Details
Rabbit Anti-phospho-HOMER3 (Thr36) antibody
SL5392R-01 50 µL

Rabbit Anti-phospho-HOMER3 (Thr36) antibody

Sign In for Pricing
View Details