Animal-Free MIP-1 alpha/CCL3, Human (His)
MIP-1 alpha/CCL3 protein, a monokine with inflammatory and chemokinetic properties, binds to CCR1, CCR4, and CCR5 receptors. Produced by CD8+ T-cells, it inhibits various strains of HIV-1, HIV-2, and SIV in a dose-dependent manner. Additionally, MIP-1 alpha/CCL3 self-associates and forms a heterodimer with MIP-1-beta (3-69) . Animal-Free MIP-1 alpha/CCL3 Protein, Human (His) is the recombinant human-derived animal-FreeMIP-1 alpha/CCL3 protein, expressed by E. coli , with N-His. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free MIP-1 alpha/CCL3 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-mip-1-alpha-ccl3-protein-human-his.html
Purity
98.0
Smiles
ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Molecular Formula
6348 (Gene_ID) P10147 (A27-A92) (Accession)
Molecular Weight
Approximately 8-11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
