Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5)

Product Specifications

Product Name Alternative

Thyrostimulin subunit beta

Abbreviation

Recombinant Mouse Gphb5 protein

Gene Name

Gphb5

UniProt

Q812B2

Expression Region

25-130aa

Organism

Mus musculus (Mouse)

Target Sequence

SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP27A1 (G-2) AC
sc-390974 AC 500 µg/mL - 25% ag

CYP27A1 (G-2) AC

Sign In for Pricing
View Details
FUT10 Rabbit Polyclonal Antibody (PerCP)
orb2502151 100 µL

FUT10 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
BIG2 shRNA (m) Lentiviral Particles
sc-141702-V 200 µL

BIG2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Marmoset TIM-3 (C-6His)
PHV1602-01 10 µg

Recombinant Marmoset TIM-3 (C-6His)

Sign In for Pricing
View Details
Recombinant Marmoset TIM-3 (C-6His)
PHV1602-02 50 µg

Recombinant Marmoset TIM-3 (C-6His)

Sign In for Pricing
View Details
Recombinant Marmoset TIM-3 (C-6His)
PHV1602-03 500 µg

Recombinant Marmoset TIM-3 (C-6His)

Sign In for Pricing
View Details