Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83), partial

Product Specifications

Product Name Alternative

Cancer/testis antigen 83

Abbreviation

Recombinant Human CT83 protein, partial

Gene Name

CT83

UniProt

Q5H943

Expression Region

22-113aa

Organism

Homo sapiens (Human)

Target Sequence

RRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.2 kDa

References & Citations

"Identification of a new cancer/germline gene, KK-LC-1, encoding an antigen recognized by autologous CTL induced on human lung adenocarcinoma."Fukuyama T., Hanagiri T., Takenoyama M., Ichiki Y., Mizukami M., So T., Sugaya M., So T., Sugio K., Yasumoto K. Cancer Res. 66:4922-4928 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRODH2 Protein Vector (Rat) (pPM-C-HA)
PV296336 500 ng

PRODH2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ARHGEF1 (NM_199002) Human Recombinant Protein
TP321180M 100 µg

ARHGEF1 (NM_199002) Human Recombinant Protein

Sign In for Pricing
View Details
hsa-mir-100-3p RT-PCR Detection Kit
abx096084-01 50 Reactions

hsa-mir-100-3p RT-PCR Detection Kit

Sign In for Pricing
View Details
hsa-mir-100-3p RT-PCR Detection Kit
abx096084-02 100 Reactions

hsa-mir-100-3p RT-PCR Detection Kit

Sign In for Pricing
View Details
hsa-mir-100-3p RT-PCR Detection Kit
abx096084-03 200 Reactions

hsa-mir-100-3p RT-PCR Detection Kit

Sign In for Pricing
View Details
NMNAT2 Antibody, FITC conjugated
MBS7046357-01 0.05 mg

NMNAT2 Antibody, FITC conjugated

Sign In for Pricing
View Details