Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNHIT1, Human (His)

ZNHIT1 is a key chromatin remodeling protein that regulates gene expression by promoting the incorporation of histone variants H2AZ1/H2A.Z. In muscle differentiation, ZNHIT1 is recruited to the MYOG promoter, mediating H2AZ1 binding and inducing muscle-specific gene expression. ZNHIT1 Protein, Human (His) is the recombinant human-derived ZNHIT1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNHIT1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znhit1-protein-human-his.html

Smiles

MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

Molecular Formula

10467 (Gene_ID) O43257 (M1-V154) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EYS (NM_001142801) Human Over-expression Lysate
LC428283 20 µg

EYS (NM_001142801) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR561269 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Uncoated Mouse ACV-A (Activin A) ELISA Kit
E-UNEL-M0156-01 5x 96 Tests

Uncoated Mouse ACV-A (Activin A) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse ACV-A (Activin A) ELISA Kit
E-UNEL-M0156-02 15x 96 Tests

Uncoated Mouse ACV-A (Activin A) ELISA Kit

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF647 conjugate, 0.1mg/mL
BNC473261-100 1x 100 µL

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561034 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details