Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNHIT1, Human (His)

ZNHIT1 is a key chromatin remodeling protein that regulates gene expression by promoting the incorporation of histone variants H2AZ1/H2A.Z. In muscle differentiation, ZNHIT1 is recruited to the MYOG promoter, mediating H2AZ1 binding and inducing muscle-specific gene expression. ZNHIT1 Protein, Human (His) is the recombinant human-derived ZNHIT1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNHIT1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znhit1-protein-human-his.html

Smiles

MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

Molecular Formula

10467 (Gene_ID) O43257 (M1-V154) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD32 Antibody
KC-27194-01 50 μL

CD32 Antibody

Sign In for Pricing
View Details
CD32 Antibody
KC-27194-02 100 µL

CD32 Antibody

Sign In for Pricing
View Details
CD32 Antibody
KC-27194-03 1 mL

CD32 Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB510663 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Arih2 Mouse Gene Knockout Kit (CRISPR)
KN501558 1 Kit

Arih2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TYSND1 (C-term) Rabbit Polyclonal Antibody
AP54429PU-N 400 µL

TYSND1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details