Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vacuolar protein sorting-associated protein 13D (VPS13D), partial

Product Specifications

Product Name Alternative

(Vacuolar protein sorting-associated protein 13D)

Abbreviation

Recombinant Human VPS13D protein, partial

Gene Name

VPS13D

UniProt

Q5THJ4

Expression Region

3276-3558aa

Organism

Homo sapiens (Human)

Target Sequence

LKIFISAPYWLINKTGLPLIFRQDNAKTDAAGQFEEHELARSLSPLLFCYADKEQPNLCTMRIGRGIHPEGMPGWCQGFSLDGGSGVRALKVIQQGNRPGLIYNIGIDVKKGRGRYIDTCMVIFAPRYLLDNKSSHKLAFAQREFARGQGTANPEGYISTLPGSSVVFHWPRNDYDQLLCVRLMDVPNCIWSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPMTSLDYAWDEPTL

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Mediates the transfer of lipids between membranes at organelle contact sites. Functions in promoting mitochondrial clearance by mitochondrial autophagy (mitophagy), also possibly by positively regulating mitochondrial fission. Mitophagy plays an important role in regulating cell health and mitochondrial size and homeostasis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.9 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD62L (MEL-14) In Vivo Antibody - Low Endotoxin
ICH1060-100mg 100 mg

Anti-CD62L (MEL-14) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
COMMD6 (NM_203495) Human Over-expression Lysate
LC404247 20 µg

COMMD6 (NM_203495) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXO3A Recombinant Rabbit Monoclonal Antibody [SP0054]
ET1604-11 100 µL

FOXO3A Recombinant Rabbit Monoclonal Antibody [SP0054]

Sign In for Pricing
View Details
SNRPD2 (N-term) Rabbit Polyclonal Antibody
AP17756PU-N 400 µL

SNRPD2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CATSPER3 activation kit by CRISPRa
GA117660 1 Kit

Human CATSPER3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human PTBP2 activation kit by CRISPRa
GA111753 1 Kit

Human PTBP2 activation kit by CRISPRa

Sign In for Pricing
View Details