Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP8, Human (sf9, His, GST)

USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9, His, GST) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with N-His and N-GST labeled tag.

Product Specifications

Product Name Alternative

USP8 Protein, Human (sf9, His, GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/usp8-protein-human-sf9-his-gst.html

Smiles

PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

Molecular Formula

9101 (Gene_ID) P40818-1 (P734-G1110) (Accession)

Molecular Weight

Approximately 70.8 kDa

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleophosmin Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-4757R-APC-Cy5.5 100 µL

Nucleophosmin Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Villin 1 (VIL1) BioAssayTM ELISA Kit (Human)
028879 96 Tests

Villin 1 (VIL1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Mouse LanC-like protein 2, Lancl2 ELISA KIT
ELI-46488m 96 Tests

Mouse LanC-like protein 2, Lancl2 ELISA KIT

Sign In for Pricing
View Details
TRH, Free Acid
CCP1452-01 1 mg

TRH, Free Acid

Sign In for Pricing
View Details
TRH, Free Acid
CCP1452-02 5 mg

TRH, Free Acid

Sign In for Pricing
View Details
TRH, Free Acid
CCP1452-03 10 mg

TRH, Free Acid

Sign In for Pricing
View Details